KEGG   Phytobacter ursingii: AB182_24985Help
Entry
AB182_24985       CDS       T03950                                 

Gene name
glnL
Definition
(GenBank) nitrogen regulation protein NR(II)
  KO
K07708  two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]
Organism
kin  Phytobacter ursingii
Pathway
kin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kin00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB182_24985 (glnL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kin01001]
    AB182_24985 (glnL)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kin02022]
    AB182_24985 (glnL)
Enzymes [BR:kin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AB182_24985 (glnL)
Protein kinases [BR:kin01001]
 Histidine kinases
  NtrC family
   AB182_24985 (glnL)
Two-component system [BR:kin02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   AB182_24985 (glnL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS PAS_4 PAS_8 PAS_9 DUF1688 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AKL14329
UniProt: A0A0G3QEU0
Position
4540429..4541478
Genome map
AA seq 349 aa AA seqDB search
MASGSLPDAGQILNSLINSILLVDDELAVHYANPAAQQLLAQSSRKLFGTPLPDLLSYFS
LNIVLMRESLDAGQGFTDNEVTLVIDGRSHILSLTAQRLPEGLILLEMAPMDNQRRLSQE
QLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRN
LVDRLLGPQQPGMHVTESIHKVAERVVKLVSMELPDNVTLVRDYDPSLPELAHDPDQIEQ
VLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGVRYRLAARIDVEDNGPGIPSNLQDTL
FYPMVSGREGGTGLGLSIARSLIDQHSGKIEFTSWPGHTEFSVFLPIRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtggctcgttgcccgatgctgggcagatcctcaattctttaatcaatagcatc
ttgctggttgatgacgaactggcggtacattacgccaacccggcggcgcagcaacttctg
gcgcaaagttcccgtaaattattcggtacgccgttgccggacctgctgagctatttctcg
ctcaatatcgttctgatgcgggaaagtctcgatgctggacaaggctttacggacaatgaa
gtgaccctcgttatcgacgggcgctcacatattctctcgttaacggcgcaacggttgcct
gaggggctcatcctgctggagatggcgccgatggacaatcagcgacgactgagccaggaa
caactccagcatgcccagcaagtggcagcacgcgatctggtacgcggcctggcgcatgaa
atcaaaaatccgctcggaggcttacgtggtgcggcgcagctcttaagcaaagccctgcct
gacccttcattgctggagtacaccaaagtcatcattgaacaggccgatcgtctgcgtaac
ctggtggaccgactgcttgggcctcaacagcccggtatgcacgtaacagaaagcatacac
aaagtcgctgaacgcgtcgtgaagctggtgtcgatggaattgcctgataacgtcaccctg
gtccgcgactatgacccaagtctgcctgagctggcacacgatcccgaccagattgagcag
gtgctgctgaacattgttcgcaacgcgctacaggcgctgggacctgagggcggcgaaatt
attctgcgtactcgtaccgcgtttcagctcactctgcacggcgttcgctatcgccttgcg
gcacgtattgatgtggaagataacggaccaggtattccgtcaaacctgcaggacacgctg
ttttacccgatggtgagcggacgtgaaggtggtactggcttagggttatctatcgctcga
agtttgattgatcaacattctggcaaaattgaattcaccagttggccaggccataccgag
ttctcggtgttcctgcctattcggaaatag

DBGET integrated database retrieval system