KEGG   Kitasatospora sp. MMS16-BH015: CFP65_0700Help
Entry
CFP65_0700        CDS       T05366                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00740  Riboflavin metabolism
kit00790  Folate biosynthesis
kit01100  Metabolic pathways
kit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CFP65_0700
   00790 Folate biosynthesis
    CFP65_0700
Enzymes [BR:kit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CFP65_0700
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CFP65_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AUG75652
UniProt: A0A2H5AU38
Position
complement(791275..792561)
Genome map
AA seq 428 aa AA seqDB search
MTIQPVHEIHEGFPGDALALDPVEHAITDIALGRPVIVVDDEDRENEGDIVFAASAATPE
LMAFTIRYSSGVICVPMTGEELDRLKLPPMTQVNEDRKGTAYAVSVDAREGVDTGISAAD
RARTVRLLATEATEPTDLTRPGHVFPLRAVEGGVLVRPGHTEAAVDLARLAGLAPAGAIA
EVVNDDGTMARLPELVAFAREHGLAIISIEDLIAYRRRTELHVTRAATTALPTAHGEFTA
VGYKGTIDGVEHLALVAGGLDEDGKLPVGEDVLVRVHSECLTGDVFGSLRCDCGPQLQAS
LAEVAAAGRGVVLYLRGHEGRGIGLAHKLRAYELQERGRDTVDANLELGLPADARDYSIG
AQMLTDLGVRSLTLLTNNPDKLAALTEHGLVVQARRPVAVEPGEHNAAYLRTKRDRMGHE
LPWLDNNS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccagcctgttcacgagatccacgagggcttccccggcgacgcgctggccctc
gacccggtcgagcacgccatcaccgacatcgcgctcggccgcccggtgatcgtcgtcgac
gacgaggaccgcgagaacgagggcgacatcgtcttcgccgcctcggccgcgaccccggag
ctgatggccttcaccatccgctactcctccggcgtgatctgcgtgccgatgaccggcgag
gagctggaccgcctcaagctgcccccgatgacccaggtcaacgaggaccgcaagggcacc
gcctacgccgtctcggtggacgcccgcgagggcgtggacaccggcatctcggccgccgac
cgggcccgcaccgtgcggctgctggccaccgaggccaccgagccgaccgacctgacccgc
ccgggccacgtcttcccgctgcgcgccgtcgagggcggcgtgctggtgcgccccggccac
accgaggccgccgtggacctggcccgcctggccgggctggccccggccggcgcgatcgcc
gaggtggtcaacgacgacggcaccatggcccggctgcccgagctggtcgccttcgcccgc
gagcacggcctggcgatcatctcgatcgaggacctgatcgcctaccgccgccgcaccgag
ctgcacgtcacccgcgccgccaccaccgccctgcccaccgcccacggcgagttcaccgcc
gtcggttacaagggcaccatcgacggggtcgagcacctcgcgctggtggccggcggcctg
gacgaggacggcaagctgccggtcggcgaggacgtgctggtgcgggtgcactccgagtgc
ctgaccggcgacgtgttcggctcgctgcgctgcgactgcggcccgcagctgcaggcctcg
ctggccgaggtggccgccgccggccgcggcgtggtgctctacctgcgcggccacgaggga
cgcggcatcggcctggcccacaagctgcgcgcctacgagctccaggagcgcggacgtgac
accgtcgacgccaacctcgagctcggcctgcccgccgacgcccgcgactacagcatcggc
gcgcagatgctcaccgacctgggcgtccgctcgctgaccctgctgaccaacaacccggac
aagctcgccgcgctcaccgagcacggcctggtcgtccaggcccgccgcccggtggccgtc
gagcccggcgagcacaacgcggcgtacctgcgcaccaagcgcgaccggatgggccacgag
ctgccctggctcgacaacaactcctga

DBGET integrated database retrieval system