KEGG   Kitasatospora sp. MMS16-BH015: CFP65_1243Help
Entry
CFP65_1243        CDS       T05366                                 

Definition
(GenBank) Putative aminotransferase
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00261  Monobactam biosynthesis
kit01055  Biosynthesis of vancomycin group antibiotics
kit01100  Metabolic pathways
kit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    CFP65_1243
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CFP65_1243
Enzymes [BR:kit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     CFP65_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AUG76146
UniProt: A0A2H5AVH1
Position
1463364..1464680
Genome map
AA seq 438 aa AA seqDB search
MHLTHDQLSPALARPVMRSAVFLNEAAAQHPEALSLAAGRPFDDFFDPADLVDHLNAFEQ
HLVDSGLGRSEITRLLFQYGRTAGHIQDLIASQLANDEGMHIDPAALVVTVGAQEGMFIT
LQALCHRPQDVLLVASPCYIGMLGVAELLGVPVVPVPEGEHGLDPTEVARVAAEVRADGR
TPRAFYLVPTGSNPSGRTMPLPQRHRLLAVAEEADLLLLEDDPYGFLTDGPEWVPTLKAL
DTAQRVIHIGTFAKTCYPGARVGYVVADQRVHHADGRISLLSDELALIRSMVTVNTSAVS
QAVIGGMLVRADCSLRKINTERVAHYRSNLALLLDCLDQGLPEARRLDLGISWTAPDTGF
FVVIRVPFSVDEALLIRSAEEYGVLWTPMSYFYPGEGGTEELRVSCSALSPTDLAEAVRR
LTRFLDDTASAVRTTTRG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcacccatgaccaactgagccccgcgctcgcgcgccccgtcatgcgctccgcc
gtcttcctcaacgaagcggccgcccagcaccccgaggcactcagcctcgccgccggacgg
cccttcgacgacttcttcgaccccgccgacctcgtcgaccacctgaacgccttcgagcag
cacctcgtcgactcgggcctgggccgaagcgagatcacccgcctgctcttccagtacggg
cgcaccgccggccacattcaggacttgattgccagccaactcgccaatgacgaagggatg
cacatcgatccggcggccctggtggtgaccgtaggcgcccaggaaggcatgttcatcacc
ctgcaggccctctgccaccgaccccaggacgtcctgctcgtcgcgtcaccctgctacatc
ggcatgctcggtgtggcggagctgctcggcgtgccggtggtcccggtccccgagggcgag
cacgggctcgacccgaccgaggtggcccgggtggctgccgaggtccgggccgacgggcgg
accccccgcgccttctacctcgtccccaccgggtccaatccctccgggcgcaccatgccg
ctgccccagcgccaccgactgctcgccgtcgccgaggaggccgatctgctgctgctcgag
gacgacccgtacgggttcctgaccgacggcccggagtgggtccccaccctcaaggcgctc
gacaccgcccaacgcgtcatccacatcggcacgttcgccaagacgtgctaccccggcgcg
cgcgtgggttatgtcgtcgccgaccagcgggtccatcacgccgacgggcggatcagcctg
ctctcggacgaactggccctgatccgcagcatggtcacggtgaacacctccgccgtgtcc
caggccgtgatcggcggcatgctggtgcgcgccgactgctcgttgcggaagatcaacacg
gagcgggtcgcgcactaccgcagcaacctggcactgcttctggactgcctcgaccaaggc
cttcccgaagcccgccgcttggacctcggcatctcctggaccgctccggacaccggcttc
ttcgtcgtcatccgggtgccgttctccgtggacgaagcgctcctgatccgctcagccgag
gagtacggcgtgctgtggaccccgatgtcctacttctaccccggcgagggcggcaccgag
gagctgcgggtgagctgcagtgcgctgtcaccgaccgatctggcggaggcggtgcgccga
ctcacgcgcttccttgacgacaccgcttccgccgtacgcacgacgacgaggggatga

DBGET integrated database retrieval system