KEGG   Kitasatospora sp. MMS16-BH015: CFP65_1346Help
Entry
CFP65_1346        CDS       T05366                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00903  Limonene and pinene degradation
kit00930  Caprolactam degradation
kit01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFP65_1346
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CFP65_1346
Enzymes [BR:kit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CFP65_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Thioesterase
Motif
Other DBs
NCBI-ProteinID: AUG76245
UniProt: A0A2H5AVU2
Position
complement(1584011..1584952)
Genome map
AA seq 313 aa AA seqDB search
MSRHQRDRIDALLRHPRPERPPTVEELRAGFRKLMAGMLVPHDRIRTTPATLGDRPALRV
EPTTPAPATAAAAAAETGTILYFHGGGWVFGSPETALSLTGHLVARTGLGAYSVDYRLAP
EHPFPAAIEDTLSAYRALLDRGTDPADVVFAGDSAGGGLAVTTCLAARDAGLPQPAAVLA
LSPSVDATRSGESMVTKEGIDPIFTRADLDHTGAMYLAGADPRDPLLSPAVHADLRGLPP
MLIQVGANELLLDDSTRLAARAAAAGVDVILDVTAGVPHVFQCFAGVLDEADEALDRAAL
FLKQRVRKQGVKE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcatcagcgagaccggatcgacgcactgttgcggcacccgcgccccgaacgg
cccccgacggtcgaggagctgcgcgccgggttccggaagctgatggccgggatgctggtg
ccgcacgaccgcatccgcaccacccccgccaccctcggtgaccgccccgcgctgcgcgtc
gagccgacgaccccggccccggctacggctgcggctgcggctgcggagaccgggacgatc
ctgtacttccacggcggcggctgggtgttcggctcgccggagaccgccctctcgctcacc
ggccacctggtggcccggaccggcctcggggcgtactccgtcgactaccggctggccccc
gagcaccccttcccggccgcgatcgaggacaccctgagcgcgtaccgggccctgctcgac
cgcggcacggacccggcggacgtcgtcttcgcgggggattcggcgggcggcggactcgcc
gtcaccacctgcctcgccgcccgggacgccgggctgccgcagccggccgccgtgctggcc
ctctcgccgagcgtggacgcgacccggtcgggcgagagcatggtgaccaaggaggggatc
gacccgatcttcacccgggcggacctggaccacaccggggcgatgtacctcgcgggggcg
gacccgcgcgatccgctgctcagcccggcggtgcacgccgacctccgcggcctgcccccg
atgctgatccaggtcggggccaacgagctgctgctcgacgactcgacccggctggccgcg
cgggccgccgccgcgggcgtggacgtgatcctggacgtcacggcgggcgtgccgcacgtc
ttccagtgcttcgccggggtgctcgacgaggcggacgaggcgctggaccgtgccgcactg
ttcctcaagcagcgagtccggaagcagggagtgaaggagtag

DBGET integrated database retrieval system