KEGG   Kitasatospora sp. MMS16-BH015: CFP65_1552Help
Entry
CFP65_1552        CDS       T05366                                 

Definition
(GenBank) hypothetical protein
  KO
K21302  phosphatidylinositol-3-phosphatase [EC:3.1.3.64]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00562  Inositol phosphate metabolism
kit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CFP65_1552
Enzymes [BR:kit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     CFP65_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase He_PIG
Motif
Other DBs
NCBI-ProteinID: AUG76442
UniProt: A0A2H5AWD1
Position
complement(1832698..1834350)
Genome map
AA seq 550 aa AA seqDB search
MRPTLLTSAAATLGLLAGLCGLAAAPATAVTPAPAVTTAHAATTVAATAAVPRPDHVVVV
VFENTSEGSIIGSPDAPYFNQLANSGANFTNAFAIEHPSQPNYLDLFSGSNQGVTDDSCP
HTFSSDNEAAQLIAKGLTFTGYSETLPSAGSTVCTAGTSGYARKHNPWVNFTNVPAADNQ
PFSAFPTDFTKLPTVSWVVPNLCNDMHDCSTATGDSWLQAHLDAYVQWAKTHNSLLITTF
DEDDSSTSANQIATIFDGQPVKVGTYTEHVDHFGVLRTIEDMYGLPYAGAAANATSITDA
WTGSAPGGSVTVANPGSQTGTVGTAASLQVSATDTAGGTLSYSATGLPAGLGINAGTGLI
SGTPTTAGTAAVTVTATDSTGPSGSASFSWQVNPAGGGGCTAAQLLGNPGFETGSAAPWT
ASSGVIDNSSNEAAHGGSWKAWLDGYGSAHSDTLSQTVTVPAGCTKATLTYWLHVDTAET
GSTAYDKLTLTANGTTVASYSNVDAASGYTQRTVNLAAYVGKSVTLKFTGTEDSSQQTSF
VIDDAALNVG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccccacactgctgacctcggccgcagccaccctcggcctgctggccggcctctgc
ggcctggccgccgccccggccaccgccgtcaccccggccccggccgtgaccaccgcccac
gccgccaccaccgtggccgcgacggccgccgtgccccggcccgaccacgtggtggtcgtg
gtgttcgagaacacctcggagggttcgatcatcggctcgcccgatgccccgtacttcaac
cagctggcgaacagcggcgcaaacttcaccaacgccttcgcgatcgagcaccccagccag
ccgaactacctggacctcttctcgggctccaaccagggcgtgacggacgactcctgcccg
cacaccttctcctccgacaacgaggccgcccagctgatcgccaagggcctcaccttcacc
gggtactcggagaccctgccctcggccggctccaccgtctgcaccgcgggcaccagcggg
tacgcgcgcaagcacaacccctgggtgaacttcaccaacgtgccggccgccgacaaccag
ccgttctcggccttcccgaccgacttcacgaagctgcccaccgtctcctgggtggtcccg
aacctctgcaacgacatgcacgactgctccaccgccaccggtgacagctggctccaggcg
cacctggacgcgtacgtgcagtgggccaagacgcacaacagcctgctgatcaccaccttc
gacgaggacgacagctccaccagcgccaaccagatcgccaccatcttcgacggccagccc
gtcaaggtgggcacctacaccgagcacgtggaccacttcggcgtgctgcgcaccatcgag
gacatgtacggcctgccgtacgcgggcgccgccgccaacgccacgtcgatcaccgacgcc
tggacgggttcggcccccggcggcagcgtcacggtggccaaccccggcagccagaccggc
acggtcggcaccgccgcctcgctccaggtcagcgccaccgacacggccggcggcacgctc
tcgtacagcgcgaccggcctgcccgccgggctgggcatcaacgccggcaccggcctgatc
tccggcaccccgaccacggccggcaccgccgccgtgaccgtcaccgcgaccgactccacc
ggcccgagcggcagcgcgagcttcagctggcaggtcaacccggccggtggcggcggctgc
acggcggcccagctgctcggcaaccccggcttcgagaccggctccgccgccccctggacg
gccagcagcggcgtgatcgacaactcctcgaacgaggcggcccacggcggcagctggaag
gcctggctggacggctacggcagcgcccacagcgacacgctgagccagaccgtcaccgtg
ccggccggctgcaccaaggccacgctcacctactggctgcacgtggacaccgccgagacc
ggcagcaccgcctacgacaagctcaccctgaccgccaacggcaccacggtggctagctac
tccaacgtggacgccgccagcggctacacccagcgcacggtcaacctcgccgcctacgtg
ggcaagagcgtcacgctcaagttcaccggcaccgaggactccagccagcagaccagcttc
gtgatcgacgacgcggcactcaacgtcggctga

DBGET integrated database retrieval system