KEGG   Kitasatospora sp. MMS16-BH015: CFP65_3416Help
Entry
CFP65_3416        CDS       T05366                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00998  Biosynthesis of secondary metabolites - other antibiotics
kit00999  Biosynthesis of secondary metabolites - unclassified
kit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    CFP65_3416
   00999 Biosynthesis of secondary metabolites - unclassified
    CFP65_3416
Enzymes [BR:kit01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     CFP65_3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AUG78212
UniProt: A0A2H5B1C8
Position
4004647..4005681
Genome map
AA seq 344 aa AA seqDB search
MSPTSTAPPFAVISGAQVHGVLDDRKKEVVELVEQAYRIHGEGDTVNPPSYFLRFPDRPS
SRIIALPASIGGEVRVDGLKWISSFPENVAAGIPRASAVLILNDHETGYPLACLESSIIS
ASRTAASAALAADRLTAGQERPRRIGFIGVGLIARYIHAYLAGTDWTFDSAGVFDLSAEH
AEGFAGYLAGTDGVGEVTVHESAEALIRSSDLVVFATVAGAPHIHDPEWFSHNPLVLHVS
LRDLAPEVVLAATNIVDDVEHSLKADTSLHLAEQQTGHRDFVDGTLYDVLTGAVTPAADR
PVIFSPFGLGVLDLAVGKHVYDSVRAAGELAVVEDFFHEMRRYG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaaccagcacggcccccccattcgccgtgatatccggcgcccaggtgcacggc
gtcctcgacgaccggaagaaggaggtggtcgagctggtcgaacaggcctaccgcatccac
ggcgagggcgacaccgtgaacccgccctcgtacttcctgcgcttccccgaccgccccagc
tcccggatcatcgcgctgccggcctccatcggcggcgaggtgcgggtggacgggctgaag
tggatctccagcttcccggagaacgtcgcggccgggatcccgcgcgcctcggccgtcctg
atcctcaacgaccacgagaccggctacccgctggcctgcctggagagctccatcatcagc
gcctcccggacggccgcctcggccgcgctggccgccgaccggctcaccgccggccaggag
cggccgcgccggatcggcttcatcggcgtcggcctgatcgcccgctacatccacgcctac
ctggccggcacggactggaccttcgactccgccggggtcttcgacctctccgccgagcac
gcggagggcttcgccggctacctggcgggcaccgacggggtcggcgaggtcaccgtgcac
gagagcgccgaggcgctcatccgcagcagcgacctggtggtcttcgccaccgtggccggc
gccccgcacatccacgaccccgagtggttctcgcacaacccgctggtcctgcacgtctcg
ctgcgcgacctcgcccccgaggtggtgctcgcggcgaccaacatcgtcgacgacgtcgag
cacagcctgaaggccgacacctcgctccacctggccgagcagcagaccggccaccgcgac
ttcgtcgacggcacgctgtacgacgtgctgaccggcgcggtcaccccggcggccgaccgc
ccggtgatcttctcgccgttcgggctcggggtgctcgacctggcggtcggcaagcacgtc
tacgactccgtccgcgcggccggcgagctggccgtcgtcgaggacttcttccacgagatg
cgcagatacggctga

DBGET integrated database retrieval system