KEGG   Kitasatospora sp. MMS16-BH015: CFP65_4599Help
Entry
CFP65_4599        CDS       T05366                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00450  Selenocompound metabolism
kit00970  Aminoacyl-tRNA biosynthesis
kit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFP65_4599
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFP65_4599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kit01007]
    CFP65_4599
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kit03016]
    CFP65_4599
Enzymes [BR:kit01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CFP65_4599
Amino acid related enzymes [BR:kit01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CFP65_4599
Transfer RNA biogenesis [BR:kit03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CFP65_4599
 Prokaryotic type
   Other AARSs
    CFP65_4599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AUG79336
UniProt: A0A2H5B4K1
Position
5356810..5358411
Genome map
AA seq 533 aa AA seqDB search
MPATEEQRTYYVTTPIYYVNDRPHLGHAYTTVAGDVLTRWHRQRGEKVHYLTGTDEHGQK
ILRTAEAHGVTPQEWCDRLVAEAWRPLWEHLRIANDDFIRTTEPRHTARAAEFVQGLYDR
GEIYRGAYEGPYCVGCEEYKLPAELLPGATEEERLCPVHRRPVEWLAEENYFFRLSAYAL
RLLEHYAAHPEFIQPASARNEVLRFVEQGLQDLSISRSTFDWGVPLPWDDKHVLYVWVDA
LQNYLTAAGHGADPERFAELWPASVHLVGKDILRFHAVIWPAMLLAAGLPLPKRVVANGW
LMVGGEKMSKSNLTGISPTDLTAHFGVDAYRYYFLRAIPYGTDGSFSWEDFTARYTSELA
NDFGNLASRLAAMVGRYFDGSLPAAVEPGPAEAAVAAALTGAVAEADRRIGEELDFAGGL
GAVFDFVRVVNGYLSDQAPWQVAKDPSDAARGRLATILYTAAEGLRALAVLLNPVMPDTA
AKLWESLGAAPLLGPLAGQTIATAADWGRLPAGATITKGEILFPRLEALEEKH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaccgaagagcagcgcacgtactacgtcaccaccccgatctactacgtgaac
gaccgcccgcacctgggccacgcgtacaccacggtcgcgggcgacgtgctcacccgctgg
caccgccagcgcggcgagaaggtgcactacctgaccggcaccgacgagcacggccagaag
atcctccggacggccgaggcgcacggggtcaccccgcaggagtggtgcgaccggctggtg
gccgaggcctggcgcccgctctgggagcacctgcggatcgccaacgacgacttcatccgc
accaccgagccccggcacaccgcgcgggcggccgagttcgtccagggcctgtacgaccgg
ggcgagatctaccggggcgcgtacgagggcccgtactgcgtgggctgcgaggagtacaag
ctgcccgccgagctgctgcccggcgccaccgaggaggagcggctctgcccggtgcacagg
cgcccggtggagtggctggccgaggagaactacttcttccggctctccgcctacgccctg
cggctgctggagcactacgcggcccaccccgagttcatccagcccgcctcggcccgcaac
gaggtgctgcgcttcgtcgagcagggcctgcaggacctctcgatctcccgctcgaccttc
gactggggcgtcccgctgccctgggacgacaagcacgtgctctacgtctgggtcgacgcg
ctgcagaactacctcaccgccgccggccacggcgccgacccggagcggttcgccgagctc
tggcccgcctcggtgcacctggtgggcaaggacatcctgcgcttccacgcggtgatctgg
cccgcgatgctgctggccgccgggctgccgctgccgaagcgggtggtggccaacggctgg
ctgatggtcggcggcgagaagatgtccaagtcgaacctgaccggcatctccccgaccgac
ctgaccgcgcacttcggcgtggacgcctaccgctactacttcctgcgggccatcccgtac
ggcaccgacggctccttctcctgggaggacttcaccgcccggtacacctccgagctggcc
aacgacttcggcaacctcgcctcccggctggccgcgatggtgggcaggtacttcgacggc
tcgctgccggccgccgtcgagcccggcccggccgaggcggcggtggccgccgcgctgacc
ggggccgtggcggaggccgaccggcggatcggcgaggagctggacttcgcgggcgggctc
ggggcggtcttcgacttcgtccgggtggtcaacggctacctgagcgaccaggcgccctgg
caggtggccaaggacccctcggacgccgcccggggccggctcgccaccatcctgtacacc
gccgccgagggcctgcgggcgctcgcggtgctgctcaacccggtgatgccggacaccgcc
gccaagctctgggagtcgctgggcgcggcgccgctgctcggcccgctggccgggcagacc
atcgccaccgccgccgattggggccggctgcccgccggtgcgaccatcaccaagggggag
atcctcttcccccgtctcgaagccctggaagagaagcactga

DBGET integrated database retrieval system