KEGG   Kitasatospora sp. MMS16-BH015: CFP65_5940Help
Entry
CFP65_5940        CDS       T05366                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00460  Cyanoamino acid metabolism
kit00500  Starch and sucrose metabolism
kit01100  Metabolic pathways
kit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFP65_5940
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CFP65_5940
Enzymes [BR:kit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CFP65_5940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AUG80617
UniProt: A0A2H5B8B4
Position
7045072..7046454
Genome map
AA seq 460 aa AA seqDB search
MTSTRFPGRQTVDFLSDLPAGFRWGAATAAYQIEGAATEDGRAPSIWDTFSHTPGKVAAG
DTGDVACDHYHRWPEDLALMGRLGLDSYRFSIAWPRVVPQADGRVNPAGLDFYDRLVDGL
LAAGITPFPTLYHWDLPQAQQDRGGWPERSTAERFGEYAAVVGERLGDRVTHWATLNEPL
CSAWIGHLDGAMAPGLTDLTAAVRASCHLHLAHGLAVQALRATVPGAQLGIVNNLSTIEP
AGDSEADLAAARRADGHVNRWWLDPVLGRGYPADMVELYGVEIPLKDADLATIAAPLDWL
GLNYYFRQIVTDDPTGPAPYARQVTGPGPEFTAMPWEVHAPGLEQLLLRLTHEYGARRIY
VTENGSAYEDTPAADGSVQDPERTAYLELHLAACARAVAQGAPLAGYFAWSLLDNFEWAY
GYAKRFGLVHVDYPTQRRTVKASGHRYAELIRAHRSGRSA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacccgctttcccggaaggcaaacagtggacttcctgagtgacctccccgcc
ggcttccgctggggtgccgcgaccgccgcctaccagatcgagggcgccgccaccgaggac
ggccgggccccctcgatctgggacaccttctcccacacccccggcaaggtcgccgccggt
gacaccggggacgtggcctgcgaccactaccaccgctggcccgaggacctcgccctgatg
gggcgactcggcctggactcctaccggttctcgatcgcctggccccgggtggtgccgcag
gccgacggcagggtcaaccccgccggtctcgacttctacgaccgcctggtggacggcctg
ctggccgccgggatcacccccttcccgaccctctaccactgggacctcccgcaggcccag
caggaccgcggcggctggcccgaacgctccaccgccgagcggttcggcgagtacgccgcc
gtggtgggcgagcgcctcggcgaccgggtcacccactgggccaccctcaacgagccgctc
tgctcggcctggatcggccacctggacggcgcgatggcccccggcctcaccgacctgacc
gccgccgtccgcgcctcctgccacctccacctggcccacggcctggccgttcaggccctg
cgcgccaccgtgcccggcgcccagctcggcatcgtcaacaacctcagcaccatcgagccg
gccggcgacagcgaggccgatctggccgccgcccgccgcgccgacggccacgtcaaccgc
tggtggctcgacccggtgctcggccggggctacccggcggacatggtcgaactctacggc
gtggaaatcccgttgaaggatgccgacctggccaccatcgccgcaccgctggactggctc
ggcctgaactactacttccgccagatcgtcaccgacgacccgaccggcccggcgccgtac
gcccgccaagtgaccggccccgggccagagttcaccgcgatgccctgggaggtgcacgcc
ccgggcctggagcagctgctgctccggctcacccacgagtacggcgcccggcggatctac
gtgaccgagaacggctccgcctacgaggacaccccggccgccgacggcagcgtgcaggac
ccggagcgcaccgcctacctggagctgcacctggccgcctgcgcccgcgcggtggcccaa
ggcgccccgctggccgggtacttcgcctggtcgctgctggacaacttcgagtgggcgtac
ggctacgccaagcggttcggcctggtgcacgtggactacccgacccagcggcggacggtc
aaggccagcggccaccggtacgcggagctgatccgggcgcaccggagcggccgatcagcc
tag

DBGET integrated database retrieval system