KEGG   Kingella kingae: KKKWG1_0053Help
Entry
KKKWG1_0053       CDS       T04151                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
kki  Kingella kingae
Brite
KEGG Orthology (KO) [BR:kki00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    KKKWG1_0053 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF3859 DUF4354
Motif
Other DBs
NCBI-ProteinID: CRZ19229
UniProt: A0A0N7LHI2
Position
I:48030..48401
Genome map
AA seq 123 aa AA seqDB search
MEHNILIHVTPQYCATDSDIIQSRFAFSYKIKIENRSDEIITLRTRTWKITDACGNIENV
HGVGVVGEQPTLYSGDCFEYQSGTQLDTPWGSMEGQYEFETSWGGRIEVAIPRFELKSDI
LPQ
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaatattttgattcacgttacaccgcaatattgcgccaccgacagcgacatc
atacaaagccgatttgcgttttcctacaaaattaagattgaaaaccgcagcgatgaaatc
atcacgctccgcacccgaacatggaaaattaccgacgcttgtggcaacatagaaaatgta
cacggcgtaggcgtagtgggcgaacagccgactttgtattcgggcgattgttttgaatac
caaagtggcacgcagctcgacacaccttggggcagcatggaagggcaatacgaatttgaa
acgagctggggcggacgcattgaagtggcaattccgcgctttgaattgaagtcggatatt
ttgccgcagtaa

DBGET integrated database retrieval system