KEGG   Kingella kingae: KKKWG1_0281Help
Entry
KKKWG1_0281       CDS       T04151                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kki  Kingella kingae
Pathway
kki00260  Glycine, serine and threonine metabolism
kki01100  Metabolic pathways
kki01110  Biosynthesis of secondary metabolites
kki01120  Microbial metabolism in diverse environments
kki01130  Biosynthesis of antibiotics
kki01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKKWG1_0281 (ltaE)
Enzymes [BR:kki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KKKWG1_0281 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CRZ19456
UniProt: A0A0P1D0B8
Position
I:255275..256249
Genome map
AA seq 324 aa AA seqDB search
MVVIQTANGGHVGAYGNDPYTEKLQQILKQQFGEQAQGFPVFNGSGANVLALQALLPRWG
AVVCAQTAHINVDESVAPQWVGGFKLWTIATPDGKLSPELIAQETHGFGFEHRAQPLAVS
MTQSTELGTLYTPDELRAICDFCHKNGMAVHLDGARLANAAAALGVSLREITTDVGVDIV
SFVGTKNGLLLGECVVILNPECVSDGMKYLRKMNVQLASKMRFISAQLVALLENDLWLKS
ASNTNKMAQKLSGSLQNMDGVELVYPTQANAVFAKLPNGVADKVRELTYFYDWDEQGTVR
FVCSFDTTEQHVDELVAATRAAIG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggtggtaatacaaacggcaaacggtgggcacgttggcgcgtatggcaacgacccatac
acggaaaaactgcagcaaatcttaaaacagcagtttggcgaacaggcgcaaggttttcct
gtattcaatggatcaggtgcgaatgtgttggcgttgcaagcgttactgccacgttggggt
gcggtggtttgcgctcaaacggcgcacatcaatgttgatgaaagcgttgcgccacaatgg
gtaggcggtttcaaattgtggacgattgctacgcctgatggcaaattgtcgcctgaattg
attgcacaagaaacacatggttttggctttgaacatcgcgctcagccgttggcggtcagt
atgacgcaaagcacggaattaggcacattgtatacacctgacgaattgcgcgctatttgc
gatttctgccacaaaaatggcatggcggtacatttggacggtgcgcgtttggcgaatgcg
gcggcggctttgggcgtgtcgttgcgcgagattacgactgatgtgggcgtggatattgtg
tcgtttgtcgggacgaaaaatggcttgttgttgggcgaatgcgtggttattttgaatcct
gaatgtgtgtcggacggcatgaaatatttgcgtaaaatgaatgtgcagttggcatctaaa
atgcggtttatttcggcgcagttggtggctttattagaaaatgatttgtggctgaaatcg
gcaagcaatacgaataaaatggcgcaaaaactttcaggcagcctgcaaaatatggacggc
gtggaattggtttacccgacacaggcgaatgcggtttttgcgaaattgccaaacggtgtg
gcggataaggtgcgtgaattgacatatttttatgattgggacgagcaaggcacggtgcgt
tttgtgtgcagttttgatacgactgaacagcacgttgatgagttggtggcggcaactcgg
gcggcgattggttaa

DBGET integrated database retrieval system