KEGG   Kingella kingae: KKKWG1_1722Help
Entry
KKKWG1_1722       CDS       T04151                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kki  Kingella kingae
Pathway
kki00450  Selenocompound metabolism
kki00970  Aminoacyl-tRNA biosynthesis
kki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kki00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KKKWG1_1722 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KKKWG1_1722 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kki01007]
    KKKWG1_1722 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kki03016]
    KKKWG1_1722 (metG)
Enzymes [BR:kki01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KKKWG1_1722 (metG)
Amino acid related enzymes [BR:kki01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KKKWG1_1722 (metG)
Transfer RNA biogenesis [BR:kki03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KKKWG1_1722 (metG)
 Prokaryotic type
   Other AARSs
    KKKWG1_1722 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: CRZ20901
UniProt: A0A0P1D3H5
Position
I:1631016..1633070
Genome map
AA seq 684 aa AA seqDB search
MTQKRRILVTSALPYANGSIHLGHMVEHIQTDIWVRFQKSRGHECYYCCADDTHGTPIML
AAEKQGITPEQMIDKTHAEHLADFTGFGIGYDNYYSTHSPENKKYSEQIYLALKANNKIA
SKNINQLFDPEKQMFLPDRFVKGECPKCHSQDQYGDNCEVCGTTYSPTELIKPYSAVSGA
TPIMKETEHFFFKLSECGDFLKAWTSGSTNGKANLQPEALNKMNEWLKDGELSDWDISRD
APYFGFEIPDQPNKYFYVWLDAPVGYMASFQNLCDRIGLDFNEFFGKDSQTEMYHFIGKD
ILYFHALFWTAMLEFSGHRAPTGIFAHGFLTVDGQKMSKSRGTFITAKSYLEQGLNPEWM
RYYIAAKLNSKIEDIDLNLQDFIARVNSDLVGKYVNIAARASGFIAKRFSGSLQDVSGSK
LIAQLTEKSESIANDYESREYAKALREIMGLADLVNEYVDANKPWELAKQDGAEQRLHEV
CSELINAFKILTAYLSPVLPNVATQAAVFLDVEKLDWTHTVSTLPENHIINKYEHLMQRI
EEKQVNDLVEANKQTIQVAPETPAATNNEFAPVAEQCSFDDFMKVDMRVAKVLNCEAVEG
STKLLKFSLDFGFEQRTIFSGIAASYPNPAELNGTMVIAVANFAPRKMAKFGVSEGMILS
AADKDHNLKLLTVHEGAQPGDKVG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaaaacgaagaatcttggttacttccgccctgccctacgccaacggctcaatc
catttaggacacatggttgaacatatccaaaccgacatttgggtacgcttccaaaaatca
cgcggacacgaatgctattactgctgcgcggacgacacgcacggcacgccaatcatgctc
gctgccgaaaaacaaggcattacccccgagcaaatgattgacaaaacccacgccgaacat
ttggcagatttcacaggttttggcattggctacgacaattattactcaacccattcgcct
gaaaacaaaaaatattccgaacaaatttacttggcactcaaagccaacaacaaaatcgcc
agcaaaaacattaaccaactgtttgaccccgaaaaacaaatgtttttgcccgaccgtttt
gtcaaaggcgaatgccccaaatgccactcccaagaccaatacggcgacaactgcgaagtg
tgcggcacaacctactcgccaaccgaattgattaaaccgtattccgccgtgtcaggcgca
acgcccatcatgaaagaaaccgaacatttcttttttaaattgagcgaatgcggcgatttt
ctcaaagcgtggacttcaggcagcaccaacggcaaagccaatttgcagcctgaagcctta
aacaaaatgaacgaatggctcaaagacggcgaattgtccgactgggatatttcacgcgat
gcgccttatttcggctttgaaattcccgaccaaccgaataaatatttctatgtttggttg
gacgcgcctgttggttacatggcttcattccaaaatttatgcgaccgtattggcttggat
tttaatgaatttttcggcaaagacagccaaaccgaaatgtatcatttcatcggcaaagat
attttgtatttccacgcgctgttttggacggcgatgctggaatttagtggacatcgcgct
ccaactggcattttcgcacacggctttttgactgtggacggtcagaaaatgtctaaatct
cgcggcacgtttattaccgcgaaatcgtatttggaacaaggtttaaaccctgaatggatg
cgttactacatcgccgcgaaattgaacagcaaaattgaagatattgacttgaatttgcaa
gattttatcgctcgcgtaaacagcgatttggttggcaaatatgtgaatattgccgctcgt
gcaagcggttttattgcgaaacgcttttcaggcagcctgcaagatgtttcaggcagcaaa
ttgattgctcaattaaccgaaaaatcggaatccatcgccaacgattacgaaagccgcgaa
tacgccaaagccttgcgtgaaatcatgggtttagcggatttggttaatgaatatgtggac
gcgaacaagccttgggaattggcgaaacaagacggcgcggaacagcgtttgcacgaagtg
tgcagcgaattgattaacgcattcaagattttaacggcgtatttgtcgcctgttttgccg
aatgtggcaacgcaagcggcggtgtttttggatgtggaaaaattggattggacgcacacg
gtttccacgctgcctgaaaatcacatcatcaacaaatatgaacatttaatgcaacgtatt
gaggaaaaacaagtgaacgatttagtagaagcgaacaaacaaacgattcaggtagcccct
gaaaccccagcagccacaaacaatgaatttgcgccagttgccgagcaatgcagctttgac
gattttatgaaagtggatatgcgcgtggcgaaagtgttaaactgtgaggcggttgagggc
agcacgaagttgttgaaatttagcttggattttggttttgagcaacgcacgattttctcg
ggcattgctgcgagctatccgaaccctgcggaattgaacggtacaatggtgattgcggta
gcgaatttcgcgccacgcaaaatggcaaaatttggcgtgtcagaaggtatgattttgagc
gcggcagataaagaccataatttgaaattgctgaccgtccacgaaggtgcgcagcctggc
gataaagtgggttaa

DBGET integrated database retrieval system