KEGG   Kingella kingae: KKKWG1_1797Help
Entry
KKKWG1_1797       CDS       T04151                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
kki  Kingella kingae
Pathway
kki00564  Glycerophospholipid metabolism
kki01100  Metabolic pathways
kki01110  Biosynthesis of secondary metabolites
Module
kki_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:kki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KKKWG1_1797 (psd)
Enzymes [BR:kki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     KKKWG1_1797 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CRZ20976
UniProt: A0A0P1D3S3
Position
I:1699102..1700001
Genome map
AA seq 299 aa AA seqDB search
MANLQPYSRPTCRERAKIAFHYLLPQLAVTRCAGWFADKQWGKITHFVIQQFANAYQINW
QEAKKSQASDFATFNEFFTRELKDGARPIVESNLQLCLPADGKVSESGDIDRDRLLQAKG
HSFTLSDLLAGDNELAAQFENGVFLTTYLSPKDYHRVHMPCAGTLQKMIYVSGELFSVNP
FLAQHIPNLFARNERVICVFDTDIGTMVQILVGATVTASMTTVWHGTVNPPRENGVRVWE
YPADGEQAIHLEKGAEMGAFRLGSTVVNLFMHNTVKLDSRLVAGAPTKMGESLGDLIAT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacttgcaaccttactcgcgccctacttgccgtgaacgcgccaaaatcgcgttt
cactatttattgccacaactggctgttacccgatgtgcaggctggtttgccgacaaacaa
tggggcaaaatcacgcattttgtgattcaacaatttgccaacgcctatcaaatcaactgg
caagaagcaaaaaaatctcaagccagcgattttgccacgtttaacgaattttttacgcgc
gaactcaaagacggcgcacgtcctatcgtagaaagcaacctgcaactttgcttgccagca
gacggcaaagtcagcgaaagcggcgacattgaccgcgaccgtctgttgcaagccaaagga
cacagcttcactttgagcgacttgttggcaggcgacaacgaacttgccgcgcaatttgaa
aacggcgtatttttaaccacttacctatcgcccaaagactatcatcgcgtacacatgccc
tgcgctggcacgttgcaaaaaatgatttatgtgtcgggcgaattgttttccgtcaatccc
tttttggcgcaacacatccccaatttattcgcccgcaacgagcgcgtgatttgcgtgttt
gataccgacattggcacaatggtacaaatcttggtgggcgcaaccgtaaccgccagcatg
actaccgtttggcacggcacagtcaatccgccacgcgaaaacggcgtgcgcgtgtgggaa
tacccagccgatggcgagcaagccatacacttggaaaaaggcgcggaaatgggcgcgttc
cgtttaggttcaacggttgtgaatttgtttatgcacaacaccgtgaagctggatagccgc
ttggtggcaggtgcgccaaccaaaatgggcgaaagtttgggcgatttgattgcgacttga

DBGET integrated database retrieval system