KEGG   Kangiella koreensis: Kkor_1245Help
Entry
Kkor_1245         CDS       T00973                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kko  Kangiella koreensis
Pathway
kko00620  Pyruvate metabolism
kko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kkor_1245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kko02000]
    Kkor_1245
Enzymes [BR:kko01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Kkor_1245
Transporters [BR:kko02000]
 Other transporters
  Primary active transporters [TC:3]
   Kkor_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1 Peptidase_M23 Apocytochr_F_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ACV26664
UniProt: C7RBM2
Position
1339736..1341541
Genome map
AA seq 601 aa AA seqDB search
MNDKPLKVTDVVLRDAHQSLFATRMRLDDMLPIAEKLDQVGFWSLETWGGATFDSCIRYL
GEDPWERLRQLKKAMPNTPMQMLFRAQNILGYRHYADDVVTAFVERAAANGMDVFRIFDA
MNDTRNLKTAIKAAVDCDKHAQGTLSYTVSPVHNIDKWLDMAKQIEDMGAHSICIKDMAG
LLKPYVAEELVSRLKETVNLPIALHCHATTGLSTATIMKAAEAGVDMVDSSISSMSMTYG
HSPTESIVSIFEETSRSTGLDLALLEEIAAYFRSVRTKYAQWEGSLKGVDSRILRSQVPG
GMLTNMESQLKEQGAEDKFDAVLAEIPKVRKDLGYLPLVTPTSQIVGTQAVLNVLTGERY
KSISKETSAVLKGEYGKPPAPVNEELQHRVLDGKEVITQRPADLLEPELERLSDELVEIA
EKENISLEGELIENVLTYALFPQIGLKFLKNKGNPDAFEPAPCSEAGSQTDSGQESSSNQ
SSTSATTMSGPESYQVSVNGKNYSVTVAPDGQIADIKSASQPTQTEAPAQSNGETVEAPM
AGNIFKVETKVGEQVEAGQTLIILEAMKMETEVKAVNSGVVSEILVAEGDSVKVGTPLVI
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaacccttaaaagttaccgatgttgttctaagagacgcacatcagtcgtta
tttgccaccagaatgcgcctggatgacatgcttcccatagcagaaaagcttgatcaggtt
ggcttttggtcattagaaacctggggcggagcgacctttgattcatgcatccgttatctt
ggcgaggatccttgggaacgcttaagacagctaaaaaaagcgatgcccaacacgccgatg
caaatgctgttccgtgcgcaaaacatactgggttaccgacattacgcagatgatgtggtc
acagccttcgttgagcgagccgccgctaatggtatggatgtgtttcgcatattcgacgca
atgaatgatacccgaaatttaaaaaccgccattaaagccgcggttgattgcgacaaacat
gctcaagggactttatcctataccgtcagccctgtgcataatatcgacaaatggcttgat
atggccaagcaaattgaagacatgggcgcccactcaatttgtattaaagatatggctggt
ttattaaagccttatgtagcagaggagctggtcagccgtttaaaagaaacggtcaattta
cctattgctctgcattgtcatgcaacgaccggtttaagcaccgccaccataatgaaagct
gcggaagccggtgtagatatggtggatagtagtatttcatccatgagcatgacttacggc
cactcgccaaccgagtccatcgtatctatttttgaagaaacctcacgcagcacaggtcta
gacctggcattgcttgaagagattgcggcttacttccgtagtgtgcgtacaaaatatgcc
cagtgggagggcagtttaaaaggtgtcgactctcgtattttacgatcgcaggttcctgga
ggcatgttgacgaatatggaaagtcagctaaaggagcagggcgcagaagataagtttgat
gccgtattggccgaaattcctaaagtacgcaaagacttggggtatttaccactggttaca
ccaacctcgcaaattgttggaacacaggcggtactgaatgtattaacaggtgaacgttat
aaaagtatcagcaaagaaacatctgctgtattaaaaggggagtatggcaagcctccggcc
cccgttaatgaagaactgcagcatcgagtgcttgatggtaaagaggttatcactcaacga
cctgctgatttgttagagcctgagcttgaacgattgagcgatgagttggttgaaatcgcc
gaaaaagagaacattagcctggaaggcgagttgattgaaaatgttctgacttatgccttg
tttccgcagattggtcttaagtttcttaaaaacaaaggcaatccagatgcctttgagcca
gcgccttgtagtgaggcgggcagtcagaccgatagtggacaagaatcaagttccaatcag
tcatcaacatctgctaccaccatgtcagggcctgagtcttatcaggtgtctgttaatggt
aaaaactattccgtaacggttgcaccggatggacagatagctgatatcaagtctgcgtct
caacccacacaaacagaggcaccagcacagtcgaatggtgaaacagtcgaagctcctatg
gcgggaaatattttcaaagtagaaactaaagttggtgagcaggttgaagccggtcaaact
ctgattattttagaagccatgaaaatggaaacggaagtgaaagcagtcaactccggtgtg
gtgtctgaaatactggtcgcagagggcgactcagtaaaagttggcacacctttagtgatt
ttgtaa

DBGET integrated database retrieval system