KEGG   Kangiella koreensis: Kkor_1516Help
Entry
Kkor_1516         CDS       T00973                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
kko  Kangiella koreensis
Pathway
kko00350  Tyrosine metabolism
kko00643  Styrene degradation
kko01100  Metabolic pathways
kko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Kkor_1516
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    Kkor_1516
Enzymes [BR:kko01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Kkor_1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 PI-PLC-X GST_C_2 PsiA GST_C
Motif
Other DBs
NCBI-ProteinID: ACV26928
UniProt: C7RCD6
Position
complement(1628502..1629149)
Genome map
AA seq 215 aa AA seqDB search
MLKLYSYWRSTAAYRVRIALNVKRLSYQMIPVHLVKDGGEQHKPEYLEQNPQGLVPLLDD
NGKLLSQSLAICEYLDESFKGPKLLPDEPFLRAKVRSLCQIVACDIHPLDNLRVLKYLKG
ELNVSDEAKDTWYRHWIHEGFRAIELELQSYKEQGFFAFGEMLTLADVFIVAQMYNARRF
NVDLTDYPRLVEVEKHCLTLDAFKDARPESQPDAE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactttatagttactggcgctcaacggcagcctaccgagtgcgtattgcgctt
aatgtgaagcgcctgtcttaccaaatgatccctgttcatttagtgaaagatggtggtgag
cagcataagcccgaatacctggagcaaaacccacaagggcttgtgcctttacttgatgac
aatggcaaactactgagtcaatccttggcaatttgtgagtatttggatgaaagtttcaag
gggccaaagttattacccgatgaaccttttttgagagctaaagtcagaagcttatgtcaa
atcgttgcatgcgacatacatccactcgataacttgagagtgcttaagtatctgaagggt
gagttgaatgtcagtgatgaagctaaagatacatggtaccgacactggattcatgaaggg
ttcagagcgattgagctagagttacaaagctacaaagagcagggctttttcgcttttggc
gagatgcttactttagcggatgtctttattgtggcacaaatgtacaatgctcgacgcttt
aatgtcgatttgactgattacccgcgtctggttgaagtagagaagcactgcttaacatta
gacgcctttaaagacgccaggccagaatcacagcctgacgctgagtga

DBGET integrated database retrieval system