KEGG   Kangiella koreensis: Kkor_1520Help
Entry
Kkor_1520         CDS       T00973                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
kko  Kangiella koreensis
Pathway
kko00360  Phenylalanine metabolism
kko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kko00790  Folate biosynthesis
kko01100  Metabolic pathways
kko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Kkor_1520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kkor_1520
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kkor_1520
Enzymes [BR:kko01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Kkor_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ACV26932
UniProt: C7RCE0
Position
complement(1632792..1633595)
Genome map
AA seq 267 aa AA seqDB search
MGTGTKYKARPMDEDGFIHYTDEEHQVWHELITRQEKLIKGRACPEYFEGLDKINLPKDR
IPQLEEVSSVLRKETGWEVAWVPALINFDKFFALLADKKFPCATFIRTREEMDYLQEPDV
FHEIFGHCAMLTNPYFAEFTSAYGKLGYEASKEDRVFLARLYWFTVEFGLINTAEGQRIY
GGGILSSIGETPHSLEDPEVIRKPFDPIDMLRTPYRIDIMQPQYFVLDDFKQLFELANSD
VMAMVKEAKRLGLHKPLFPPKEEKMAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaggtaccaagtataaagctcgtccaatggatgaagatggctttattcactat
acagacgaagaacatcaggtttggcatgagttaatcacacgccaggagaagctgatcaaa
ggtcgtgcctgtccagagtatttcgaaggacttgataagattaacttacctaaagaccgc
attccacagttagaagaggtttccagcgtacttagaaaggaaaccggctgggaagtggcc
tgggttcctgctttaattaatttcgataaattctttgctttgttggcggataaaaaattc
ccttgtgcgacttttattcgtacccgtgaagaaatggactatctgcaagaacctgatgtt
tttcatgaaatttttggccactgcgccatgctcaccaacccttattttgcagaatttacc
agtgcttacggtaaattaggctatgaagcgtcaaaagaagaccgagttttccttgctcgc
ctatattggttcactgttgaattcggtttgattaatactgcagaaggtcagcgtatatac
ggtggtggtattttgtcatcaattggtgagacgccgcatagcctggaagacccagaagtg
attcgtaagccttttgatccgattgatatgctgcgtaccccatatcgtatcgatatcatg
cagccgcagtacttcgtgctggatgatttcaagcaactttttgaattagctaactctgac
gtcatggcgatggtgaaagaggccaagcgtttaggtttgcataaaccattgtttccacca
aaagaagagaaaatggccagttaa

DBGET integrated database retrieval system