KEGG   Kangiella koreensis: Kkor_1642Help
Entry
Kkor_1642         CDS       T00973                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kko  Kangiella koreensis
Pathway
kko00260  Glycine, serine and threonine metabolism
kko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01130  Biosynthesis of antibiotics
kko01230  Biosynthesis of amino acids
Module
kko_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kkor_1642
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kkor_1642
Enzymes [BR:kko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kkor_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE DHC_N1
Motif
Other DBs
NCBI-ProteinID: ACV27054
UniProt: C7RCR2
Position
complement(1777310..1778215)
Genome map
AA seq 301 aa AA seqDB search
MRYQQLFKQLKADNKLAYIPFMLLGDPTEALSLKLIDRLVENGADALELGFAFSDPVADG
PVIQTASLRPLANGFSVQRGFDLIAKVRAKYPDLPIGILTYANLVFAPGIEQFYHDAQRA
GVDSVLIADCPVEEGNLFAGAAKTYEIETVYLAPPDASQASLQLIASNSQGYTYVLSRKG
ITGADNSQQETGTELIDNLRRLGAPPLVQGFGISKPEHVLKAAQAGVDGIITGSAIVNLI
NEHYNTPDKMLDLVSEYAKTMSNAAHNARHELNMTESIEKGSHYVDSRNNQATTAGNGTA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgttaccaacaattatttaaacaattaaaagccgataacaaattggcctatatcccc
tttatgctgctgggggacccaacagaagcgttatccttaaaactcatcgataggctagta
gagaatggtgctgatgcactggagctgggttttgccttttctgatccggtcgccgatggt
ccggttattcaaacggcgagtctaaggccattagccaatgggtttagtgttcagagaggt
tttgatttgattgctaaagtgcgagctaaatacccggatttacccatagggattttgact
tatgccaatctggtctttgcccctggtattgagcagttttatcatgatgctcaaagagca
ggtgttgactcagtgctgattgctgattgtcctgttgaagagggaaatttatttgcagga
gcagccaagacctatgagatcgaaacggtttatcttgcgcctcctgatgccagccaggcc
agtttgcaacttatcgccagcaacagtcagggttatacctatgtgcttagtcgtaaagga
attacaggtgctgataacagccagcaggaaacaggaactgaactgatcgataatctaagg
cggttaggagcaccgcctttagtgcagggctttggtatttccaagccagagcatgtgtta
aaggctgctcaagcaggtgttgatggaattattaccggctcagccatagttaacttgatc
aatgagcattataatacgccggataaaatgttagatttagtgtcggaatacgctaagact
atgtctaacgcggctcataatgcacgtcatgaactcaacatgactgaatcaattgaaaaa
ggctcacactatgtcgatagcagaaacaatcaagcaacaactgctggaaatggaacagca
ggttga

DBGET integrated database retrieval system