KEGG   Kangiella koreensis: Kkor_1692Help
Entry
Kkor_1692         CDS       T00973                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kko  Kangiella koreensis
Pathway
kko00450  Selenocompound metabolism
kko00970  Aminoacyl-tRNA biosynthesis
kko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Kkor_1692
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Kkor_1692
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kko01007]
    Kkor_1692
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kko03016]
    Kkor_1692
Enzymes [BR:kko01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Kkor_1692
Amino acid related enzymes [BR:kko01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Kkor_1692
Transfer RNA biogenesis [BR:kko03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Kkor_1692
 Prokaryotic type
   Other AARSs
    Kkor_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Adenyl_transf
Motif
Other DBs
NCBI-ProteinID: ACV27104
UniProt: C7RCW2
Position
1829826..1831850
Genome map
AA seq 674 aa AA seqDB search
MSSQRKILVTSALPYANGDIHIGHLLEYVQTDIWVRFQKSRGHQCIYVCADDTHGTPVML
RAQKEGKTPEDFIKESHQAHEQDFADCLIGFDNFHSTHSPESKELTQGIYLKLKENGHIS
SKTINQLFDPEKEMFLPDRFVKGTCPKCGSEDQYGDNCDACGATYSPTELKNPKSAVSGA
TPILKESEHFFFDLKGFEGFLREWLGADGHVQSEVQNKMNEWLDDLRQWDISRDAPYFGW
EIPGEKGKYFYVWLDAPIGYMASFKNLCDKRDDLNFDEFWGKDSDAEVYHFIGKDIIYFH
TLFWPSVLDGAGYRTPSAVWAHGFVTVNGQKMSKSKGTFIKARTYLNHFRPEFLRYYYAA
KLSNRIDDFDLNLEDFVQRVNSDLVGKLVNIASRCAGFITKQFDSNLSDSIIEPELIKQF
TEASDELAQHYENRDFGRAVKHIMALADKANAYIANEEPWNLVKNDETKERAHQVCSLGI
NMFKILTAYLAPVLPELAGKVQDFLKLDSLKWASAQDVLTGHEINKFKPMMQRIDMKQVE
AMIEDSKEDLEAEVKPEAQLDDPIKDEIQFGDFDKIDLRIAKIAKAEHVEGADKLLKLQL
DLGNGVTKQVFAGIKAAYDPADLQGKLTVMVANLAPRKMKFGMSEGMVLAAGPGGKDLWI
LNPDEGAQPGMRVK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgagctcacaacgcaaaattcttgttaccagcgcccttccctatgccaatggcgatatc
catattggtcacctgctggaatatgtgcaaaccgacatttgggttcgcttccagaagtct
cgtggacaccagtgtatctatgtctgtgctgacgatacccatggcaccccggtcatgctg
cgcgcacaaaaagaaggcaagacaccggaagactttattaaagaaagtcatcaggcgcac
gaacaggactttgctgactgtctgattggttttgataattttcacagcacccacagccca
gaatcgaaagaactgactcaaggcatatacctcaagctgaaagaaaatggtcatatcagc
tctaaaaccatcaaccagttattcgacccagagaaggaaatgttcctaccggatcgcttc
gtaaaaggcacttgcccaaaatgtggctcggaagaccaatacggcgacaactgcgatgca
tgcggtgcaacctatagcccgacggaactaaaaaatccaaaatcagcagtatccggcgca
acgccaatccttaaagagtcagagcattttttctttgacctgaaaggcttcgaaggcttc
ttgcgcgaatggttaggcgccgacggacacgttcaatcagaagtacagaacaaaatgaac
gaatggctggatgatttgcgccaatgggatatttctcgcgatgcgccctacttcggatgg
gaaattccaggcgagaaaggcaaatacttctacgtctggctggatgccccgattggttac
atggccagcttcaaaaacttgtgtgacaagcgcgatgatttgaattttgatgaattctgg
ggtaaagacagcgacgccgaggtttatcacttcatcggtaaagacattatttatttccac
accctgttctggccatcggttttagatggcgcaggctaccgcacaccaagtgcagtttgg
gcgcacggttttgtaaccgttaatggtcagaagatgtcgaaatctaaaggcaccttcatc
aaggcgcgtacttacctgaatcacttccgtcccgagtttttacgttattactacgcagcg
aaactatcgaatcgcattgatgacttcgacttaaatctcgaagacttcgtccagcgtgtt
aattccgacttggttggaaaattagtcaatatcgccagccgctgcgcaggctttatcacc
aaacagttcgatagcaatttaagcgacagcatcattgagccggaacttatcaagcaattc
actgaagcatcagatgaattagctcagcattatgagaaccgtgactttggtcgcgcagtt
aagcacatcatggcgctggccgacaaagccaatgcatacatcgccaatgaagagccgtgg
aatctggtcaagaatgatgagactaaagagcgtgcccatcaggtgtgcagtcttggcatc
aatatgtttaaaattctgaccgcttaccttgcccccgtgcttccagagttagcgggtaaa
gtgcaagacttcttaaagctagacagcttgaagtgggcaagcgcacaagacgttttaacc
gggcacgaaatcaataaattcaaaccaatgatgcaacgcatcgatatgaaacaggtcgaa
gctatgattgaagattcgaaagaagatttggaagctgaagtaaaacctgaagcacagtta
gatgatccgattaaggacgaaatccagttcggtgattttgataagattgatttacgtatc
gccaaaatcgccaaagcagagcacgtggaaggtgcggataaattacttaagctacaactg
gacttaggcaatggcgttaccaagcaagtttttgccggcattaaagccgcctacgatcca
gcggatttacaaggtaaactaaccgtgatggtcgccaaccttgcgccacgcaagatgaag
tttggtatgtcggaaggcatggtattggcagctggcccaggcggcaaagatctctggatc
ttgaatcccgatgaaggtgctcagccaggcatgcgtgtaaaataa

DBGET integrated database retrieval system