KEGG   Kangiella koreensis: Kkor_2495Help
Entry
Kkor_2495         CDS       T00973                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
kko  Kangiella koreensis
Brite
KEGG Orthology (KO) [BR:kko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kko02044]
    Kkor_2495
Secretion system [BR:kko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kkor_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA Seryl_tRNA_N TFIID_20kDa
Motif
Other DBs
NCBI-ProteinID: ACV27904
UniProt: C7R9B4
Position
complement(2697704..2698222)
Genome map
AA seq 172 aa AA seqDB search
MASIHDRLKKVRKPRVHITYDVETDGAVLEKELPFVVGVMGDFSADSTKPVKPLKERRFI
QIDKDNINEVMKNMSPGLNIKVDNTLENDGSEMAVNLKFDSMEDFEPAAIVDQVEPLKKL
MDTRNKLRDLMTKIDRSEELEGLMEKVLQNSDDLNALAEALGQIDEKTGDEQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtatacatgatcgtttgaaaaaagtgcgtaagccaagagtccacattacctat
gatgtggaaaccgatggcgcagtattggaaaaggagctgccttttgtagttggtgtcatg
ggcgattttagtgccgactctacaaaaccagtgaagccattaaaggagcgacgcttcatt
caaattgataaagacaatatcaatgaagtgatgaaaaatatgtcgccgggactcaatatt
aaagtcgacaatactttagaaaatgatggttcggaaatggcggttaacttgaagttcgat
tcgatggaagactttgagccagcagctatcgttgatcaagttgaaccattaaagaagtta
atggacacgcgtaataagttacgtgatttgatgactaagattgaccgttctgaagagttg
gaagggttaatggaaaaagtcttacaaaatagtgatgacttgaatgcgctagcagaggct
cttggacaaatcgatgaaaagacaggagatgagcaatga

DBGET integrated database retrieval system