KEGG   Kangiella koreensis: Kkor_2499Help
Entry
Kkor_2499         CDS       T00973                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
kko  Kangiella koreensis
Pathway
kko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Kkor_2499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kko02044]
    Kkor_2499
Secretion system [BR:kko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kkor_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACV27908
UniProt: C7R9N9
Position
complement(2700943..2704494)
Genome map
AA seq 1183 aa AA seqDB search
MSGTIRKIGKVITHKITITVLVVLAVIALVWFGGPLISIGGYEILASASARVSLLLIIAC
AWLGIKFWKLHQASSKNKKLIEHISKEEQDQLEIEQSSDDEIAVLEKRMSDGLQYLKKSD
FKGKNLYQLPWYVLIGPPGAGKTTSIVNSGLNLPLAEEFGASPIKGIGGTRNCDWWFTDD
AVLLDTAGRYTTQDSYREVDSRAWLGFLDLLKKSRPMRPVNGAIVTISIEDLLQKTQSEV
NELAGTIRKRIQELKMQLGVNIPVYLMLSKGDLLAGFNELFDDISRDEREEVFGFTFEVD
EDFGHHYAAAKFNQYFVELIQKIERKLTKKLQSEKSEQRRALIYSFPRQLRLAQKNIDDF
IQVAFSQNRYEEPILLRGVYFTSATQEGTPINRIGREISNSFGFQRERSAASQIEGKGYF
IKRLLQDVIFKEDKLVGINISYQKRQRLIQRVGYAVAGFCLITLSYLWSHSYANNKQIID
STSSLVSEYTEASNGGITEQSNLVELNGGLNVLKRFSSQIVANKNALSEGFGLYQGDKFS
GISSEVYSKGLTNYYGPYLKGTLEKEMLQAKNHHDYLYELLRIYLMFYLPQHKEDKDIAS
LFEHLWRRDFPGEINEELRSDLKSHLNYFLVQQMALPQQDGKLIEYAQNKLSKVSLVERV
YNSLLDNYINAMPEFKPSDYLSQKVEGYFYRKSGKSLREGIPGLYTQAGYHGVFKRESKK
ISEILSKDSWVLPSGETESLDKLSILDIQEQVRNKYFNDYIFYWKELIGDVAVREFSTPE
EGALMLQELTGVNAPIERLYSAIRDNVMLARPKAEGLDLDAAKDVVDSAGSSRVNNNINR
YERLIPDSADIDVVPEQVVNDAFGEIIHYVGDPGSASALKQSIGALKNMQIFLESISNAN
NAAEKTYEVTSSPQAASIISELEKEASVTPQPMNEWLGKVENSGKTLTNTGTYSYLNNLW
KTQVLAECRRAIEGRYPVNKRSRQDITLDDFRSFFSYGGTIDRFFDEHLSVFVDTSRGRW
RLLKDIGISNYTLRQLEKAKSIRESFFVRNGSDISVNFTLKPSSLSVNAGQVLVDIEGQV
LSYRHGPLRSYPTRWPGPKPQVATSISFTPANGGQTETVRTSGFWGMFRLLDKAKLKKTL
AYDKFLVEFKQAPFDATFELQAHSVNNPFFGSDLEGFNCPTDL
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggactataagaaaaataggtaaagtaataacacataaaatcaccataacggta
ttggtggtgctcgcagttattgctttagtatggttcggtgggcctttgattagtattggt
ggctatgaaatattagccagcgcaagtgcccgagtgagtttgttgttgattattgcatgt
gcatggctggggattaaattctggaagctgcatcaggcgagtagtaaaaacaaaaagctc
attgagcacatctcaaaagaagagcaggatcagctcgaaatcgaacagtcgtcggatgat
gagattgcagtactggagaagcgtatgtctgatgggctgcaatacctcaagaaaagcgac
tttaaaggtaaaaacctctatcaattaccctggtatgttttaattggcccgcccggcgcc
ggtaaaaccaccagcatcgttaattctgggctaaacctaccgctggcagaagagtttgga
gctagcccgattaaaggtattggtggcaccagaaattgtgattggtggtttaccgatgat
gcagtattgctggacaccgctgggcgatacaccactcaagatagttaccgagaggttgac
tcaagagcatggctgggctttctggacttgttaaaaaagtcgcgaccaatgcgaccggtt
aacggcgcaattgtcacgatcagcattgaggacttgttgcagaaaacgcagtctgaagtc
aatgagctggcaggaactattcgtaaaagaatccaggaattaaaaatgcagctgggagtc
aatatcccggtttacttaatgctaagcaaaggtgatttgttggctggcttcaacgagctg
tttgatgacatttcacgtgacgaaagagaggaagtgtttggcttcacttttgaagtagat
gaagattttggccatcattatgcggctgcaaagtttaatcaatattttgtagagttgatt
caaaagattgagcggaaactgacaaagaaactgcagtccgaaaaaagcgagcaaagacga
gctctgatttatagcttcccacgacagctacgtttagcacaaaagaatatagatgacttt
attcaggtggcttttagtcagaaccgttatgaagaaccaatcttgcttagaggtgtttat
ttcaccagcgctacccaggaaggtacgccgataaaccgtattggtcgtgagatatccaat
agcttcggttttcagcgagaacgcagcgctgcaagtcagatagaaggtaaaggttatttc
attaagcggcttttgcaggatgtcatatttaaggaagataaactggttgggattaatatc
agttaccagaaaaggcagcgcctgattcaacgtgttggctatgcagttgctggattctgt
cttatcactttgagttatctgtggtcacacagctatgctaataataagcagattatcgat
agcacctcttcgttagtatctgaatataccgaggccagtaacggtggaataacggagcag
tctaaccttgttgaactaaacggtggccttaatgtattaaagagattttctagccagata
gtggcaaataagaatgcgctaagtgagggttttggcctgtaccaaggggacaagtttagt
ggtatcagcagcgaagtatacagtaaaggattgactaattattatggcccttatctgaaa
gggaccttagaaaaagaaatgctccaggcaaaaaatcatcatgactatttgtatgaactg
ttgcgaatatatttgatgttctacttgccacagcataaagaagataaagacattgcttcg
ctatttgaacacttatggcgcagagactttccaggtgaaatcaacgaagaactcagatct
gatcttaagtcccacttgaactactttctggttcaacaaatggctctaccacagcaagat
ggcaagttgattgaatatgcgcaaaacaaactcagcaaagtgtctttggtagaacgcgtt
tataacagcctgttagataattacataaatgccatgccggaatttaagcctagcgactat
ctatcacaaaaagtcgaaggctacttctaccgaaaaagtggtaagtcgttacgagaaggg
attcccggactctacacccaggctggttatcacggcgtgttcaaaagagagagcaaaaaa
attagtgagattctgtcaaaagactcatgggtacttccttctggtgagactgaaagcctg
gataaactttcgatactcgatattcaggaacaggttcgcaataaatacttcaatgactat
atcttttattggaaagagttgatcggtgatgtggctgtcagagaattttctacacctgaa
gaaggtgctttgatgctgcaggagttgactggggtcaatgcaccgatagaaaggctgtac
tcagctatccgcgacaatgtcatgctggcaagacctaaagccgagggcttggatcttgat
gcagctaaggatgtggtcgattcagcaggttcctctcgggttaataacaatattaatcgt
tatgaaagacttattcctgacagtgctgatattgatgtggtaccagagcaggtggtcaat
gatgcatttggtgaaattattcattatgtgggtgaccccggtagtgcaagtgcgttaaag
caaagtattggtgccctcaagaatatgcagatattcctggagtcaattagtaatgctaat
aatgcagcagaaaaaacctatgaagtgaccagtagtccgcaggcagccagcattatcagt
gagcttgaaaaagaagccagcgttacgccacaaccgatgaatgaatggttgggaaaagtc
gaaaatagtggcaaaacattaactaacacgggtacctattcctatctgaataatctatgg
aagacacaggtattagctgagtgtcgtcgagctattgaaggtagatatccggtaaacaaa
agaagtcgtcaagatattactctggatgatttcagaagtttcttttcctatggcggtacc
attgaccgcttttttgatgaacacttaagtgtatttgtggacacatctcgaggtcgctgg
cgactactaaaagatattggcatcagcaactacactttaagacaactggaaaaagccaag
tcaatcagagaaagtttcttcgttaggaatggctctgacatatcagtcaactttacctta
aaaccatcaagcttaagtgttaatgcaggtcaggtattagtggatattgaaggtcaggtt
ttgtcctatcgacatggcccgttacgctcataccctacccgctggccagggccaaaacca
caagtagcaacatcgatatcctttactcctgctaacggcggtcagactgaaacagtcaga
acttcgggtttttggggtatgttcagattgctggacaaggcgaagttaaagaagacattg
gcttatgacaagtttctcgttgaattcaagcaggcgccatttgacgcaacctttgagttg
caagcccacagtgttaacaacccattttttgggtctgacctggaaggctttaactgcccg
acggatttgtaa

DBGET integrated database retrieval system