KEGG   Kangiella koreensis: Kkor_2503
Entry
Kkor_2503         CDS       T00973                                 

Definition
(GenBank) FHA domain containing protein
  KO
K11913  type VI secretion system protein
Organism
kko  Kangiella koreensis
Pathway
kko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Kkor_2503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kko02044]
    Kkor_2503
Secretion system [BR:kko02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Kkor_2503
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ACV27912
UniProt: C7R9P3
Position
complement(2707673..2709073)
AA seq 466 aa
MKQLTLRITSFHRLSPDQVATKTFDRVGGVIGRSADSDWVLPDPEKIVSSTHAVISFEAG
SYSVTDYSTNGLFINRSVEPVGKGQSRLLQDGDYLQIGEYEVEVEVRNHEAMDYEHAGGV
QKQSSYQAEPHIESAAKNEAIPAYHELATSQQAEYEQSQHETQVSSNPLHASYSAPAPKQ
SPYSSTVATDKAVEAAQQAKAQPIPEEWEQSLQAGIQSSQPTQHQPQQKVTQSQSVQASE
PQEIPPIPAAVTQHNVVASGDNGVENSSDNSQVCLTALLKGLGLNAEEIQLSNQPEFYHR
LGAALRLSLQGMLDILRARASMKSEFRVMQTTIRTQENNPLKFSINVDEAIRNLFARRIP
GFLNWDQAIQECFKDMSSHELALMAGTEGAVNAVLDQLSPENFTVEEDNNKSLEKWIPVA
KKARHWDRYKDQYKRVNEELGQGSGKRFSEEFAEAYEAQLTALGVR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaagcaattaacacttcgaattaccagttttcaccgtttatctccggatcaggtcgcg
accaagacctttgatcgagtgggtggtgttattggacgctcggcagactcagactgggtg
ctacctgacccagaaaagattgtatcgagtacccatgccgttattagttttgaagccggc
agttattcagttaccgactattcaaccaatggtttgtttatcaatcgttctgtagaaccg
gtaggaaaaggccaatctcgcctattgcaggatggagattatttgcagattggtgagtat
gaagtcgaggtcgaagtcagaaatcatgaagcaatggattatgaacatgccggaggggtg
cagaagcaaagtagctatcaggctgaaccacacattgaatcagctgctaaaaatgaagct
atccctgcataccatgagctggcaaccagccagcaagcagaatatgaacagagtcagcat
gaaactcaggtaagttcgaatcctcttcatgcgagttacagtgcaccagctcctaagcaa
agcccttattcttctactgttgcaacggataaagcagttgaagctgcgcagcaagccaaa
gctcagccaattcctgaggagtgggaacagagccttcaggccggtattcagagtagccag
ccaacgcagcatcagccacagcaaaaagtaacgcaatcacaatcagtacaagcatcagaa
ccacaagaaataccgccaattccagcagctgtaactcaacacaatgtcgtggctagcggg
gataatggagtcgaaaatagtagcgacaattcacaagtgtgcctgactgcccttttgaaa
ggactcggtttaaatgccgaggaaatccagctgagtaatcagccagagttttatcatcga
ctgggcgcagccttgaggctgtcattgcaagggatgctggatattttgcgcgctcgagcc
agcatgaaaagtgagttcagagtgatgcagaccactatcaggactcaggaaaacaatcct
ttgaaattctcaatcaatgtagatgaagcgataagaaatctttttgctcgacgtattcca
ggattcttaaattgggatcaggcaatacaggaatgctttaaagatatgagcagtcatgag
ctggcattgatggctggcacagaaggtgcggtgaatgccgtgttggatcagttaagccct
gagaactttacagtggaggaagacaataacaagagtcttgaaaagtggattccagtggcc
aagaaagcaaggcattgggatcgatacaaagaccagtataagagagttaacgaagagtta
ggccaaggttctggtaagcgtttttctgaagagtttgctgaagcgtatgaagcgcaattg
acagcattgggtgtgagatag

DBGET integrated database retrieval system