KEGG   Kluyveromyces lactis: KLLA0C14828gHelp
Entry
KLLA0C14828g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
kla  Kluyveromyces lactis
Pathway
kla00514  Other types of O-glycan biosynthesis
kla00515  Mannose type O-glycan biosynthesis
kla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    KLLA0C14828g
   00514 Other types of O-glycan biosynthesis
    KLLA0C14828g
Enzymes [BR:kla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     KLLA0C14828g
Glycosyltransferases [BR:kla01003]
 O-Glycan biosynthesis
  O-linked Man type
   KLLA0C14828g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIR PMT Ins145_P3_rec
Motif
Other DBs
NCBI-GeneID: 2891876
NCBI-ProteinID: XP_452864
UniProt: Q6CT75
Position
C:complement(1292713..1294602)
Genome map
AA seq 629 aa AA seqDB search
MSTNPVRKGRFKAYIKHDYQSFIKGDSLPYEDSLVWDLALSALTVGYLSMVHSDRYGDIS
TSEFEIWNQITDRIKGKFFIATSVPTLIEVLAKLTDMYSLNIEFWKTANNVVLASVLVTL
YGILRKSSVSVMISFLVTIMFSQISSFQDLIYTLNFDSYHLLALTLLILHWRKFQASKDF
SVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQLFAIMFC
RLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQHYSMSQHNDIPSSIIYGSSIR
LRHVNSLGGYLSALEIPYPKSNDTLVTVSDDPDDEANFWIIESNKGRNTEQTGSNALVKQ
TDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQGDQDELWKIEIQGKASFR
EVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCVDPARVNRALFYIDFVSSPE
AGVVEKYKWAPEYPFYKLAFEYVVGQFRLNKRQNIDNTSMSPPDCLSWPILFDNNNQIGK
ILWITSTVSVGVYTFMEAYSWLSWNIFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFT
YSLHRNLSVNQYMPSLLFAVIILSQFSVL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaaacccagttcgaaaaggcagatttaaagcctatatcaaacatgattaccag
tcatttatcaaaggtgattcgctaccatatgaagatagcctcgtctgggacctggcattg
agtgctttaacagttggttatctttcaatggttcattctgatagatatggcgatatttct
actagtgagtttgagatttggaatcaaattactgatagaataaagggtaagtttttcatt
gcaaccagtgtaccaacattaattgaggtgctggcgaagcttactgatatgtactctttg
aatattgagttctggaaaacagcaaataacgtggtcttggctagcgtcctggtaacgtta
tacggtattttaaggaaatctagcgtgtcagtaatgattagcttcctagtaacgataatg
ttctcgcagatatcaagtttccaagatttaatttatacgctcaactttgactcttatcat
ttgctagccttaacgttgctaatcttacattggaggaaatttcaggcctccaaagacttt
tccgtcgattggtacatgaatataacacttgtttcgatgtcattgattttcgttataagt
gggaaattcatagggttggtctcttggatatggctcattatagtttctttgaaatcactt
tggattgttgtgggtgatttggatgttaaaaacagacaactttttgccattatgttttgt
aggttattgttcttcgtcgttattcccttgatgtctttatggtactcttactcatcatta
attggtggtttcacaacatcgtcaaactcaatagcgtacatgtcgtcatctttccagcat
tattcgatgagccagcacaatgatattccatcttccatcatttacggcagttcaattagg
cttcgccatgttaattctttgggcggatatctatcagccttagaaataccataccctaaa
tctaacgacacattggtaacagtttctgacgatccagatgatgaggctaacttttggatc
attgaatctaataaaggaagaaacactgaacagacaggttcgaacgcattagtaaaacaa
acggacaaggtgaagttgagaaacaagaaaacaggtcaattattgagagcttctgaggaa
aaacctccaatatcagacaaagaatatgataagagaatatcagtaacgggtgacagtgac
tatcaaggggatcaagatgaattatggaaaattgaaattcaagggaaagcatcattcaga
gaagttttgagacctttcaaacaattcattgttttaaagaatccagctcgccgttgttcg
ttgctttcacatgaaatcaaaattccgcattggggtgacaggcgtcaagaggttctctgt
gtcgatcctgccagagtcaatagagcattgttttatattgactttgtcagctcgcctgag
gctggagttgttgagaaatacaaatgggcccctgaataccctttctataaattggctttt
gagtacgttgttggtcaattcagattgaacaaaaggcaaaacatcgataatacgagcatg
tctccacctgattgcctgtcttggccgattcttttcgacaataacaaccaaatcggtaaa
atcttatggataacttctacggtatctgtgggcgtgtacactttcatggaagcatattcc
tggttatcttggaatatttttgaagatactttacttaataccactgcaaaccaattaatg
aaaagagaagtcaccttggaggcatttttaggttggatcctgcacttatacatttttact
tacagcctgcacagaaatctttccgttaaccagtatatgccctctctattatttgcggtg
atcattctttcacagttctctgtgttatag

DBGET integrated database retrieval system