KEGG   Kluyveromyces lactis: KLLA0E19669gHelp
Entry
KLLA0E19669g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
kla  Kluyveromyces lactis
Pathway
kla03013  RNA transport
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLLA0E19669g
Ribosome biogenesis [BR:kla03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    KLLA0E19669g
Translation factors [BR:kla03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    KLLA0E19669g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF3_subunit CDPS UPF0258 Syntaxin_2
Motif
Other DBs
NCBI-GeneID: 2894757
NCBI-ProteinID: XP_454841
UniProt: Q6CMJ8
Position
E:1751471..1752304
Genome map
AA seq 277 aa AA seqDB search
MSWDDEDFAVPSGSKEKPVLNSWDDEFAENDDEPVLESWEDEETAKPKPKAAAAAAAKAP
KKASPSPAATPAATKNTMLDIDTLDDKTRKELLRKAELESDLNNAADLFGGLGVAEEHPR
ARAEREREQLAAVAQPAALTKDTPIQSHPLFSDLETKKDYQELRKALATAITSTSNKSLL
NYSGGLAIDLIRDISKPMTVENIRQTIATLNVLMKDKEREERQARLAKVKGGTATGGAGK
KKAKATRANLGGAFKKDNDFDLGGNDNFDDFGEDDFM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggacgacgaagattttgcagtgccaagtggctccaaagagaagccagtgttg
aattcatgggatgatgagttcgctgaaaacgacgatgagccggtactagagtcctgggag
gacgaggagactgctaaacctaagcctaaggcagcagcagcagctgcagccaaggctcca
aagaaagcctctccatcaccagctgctacaccagctgctacaaagaacaccatgctcgat
atcgatactcttgacgacaagacccgtaaagaactattgagaaaggctgaactggaatct
gatttgaacaacgctgcagaccttttcggcggtcttggcgtcgcagaagaacatccaaga
gcccgcgccgaacgtgaaagagaacagcttgcagctgtcgcccaacctgctgcgttgacc
aaggataccccaatccaatcgcacccattgttctcggatttggaaaccaaaaaagattac
caagaattaaggaaagcgttggctaccgcaatcacctcgacaagcaacaaatccttgttg
aactactctggtggactagccatcgacttgatcagagacatttccaaaccaatgaccgtc
gaaaacatcagacaaaccattgcgacattgaacgtattgatgaaggataaagaaagagaa
gaaagacaagctcgtttggccaaagtcaagggaggcaccgccacaggcggtgccggtaag
aagaaggccaaggctactagggctaacctcggcggtgccttcaagaaggataacgatttc
gacctaggtggtaacgataactttgacgatttcggagaagacgatttcatgtaa

DBGET integrated database retrieval system