KEGG   Kluyveromyces lactis: KLLA0E21011gHelp
Entry
KLLA0E21011g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
kla  Kluyveromyces lactis
Pathway
kla03013  RNA transport
Module
kla_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLLA0E21011g
Messenger RNA biogenesis [BR:kla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     KLLA0E21011g
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     KLLA0E21011g
Translation factors [BR:kla03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    KLLA0E21011g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 2894645
NCBI-ProteinID: XP_454900
UniProt: Q6CMD9
Position
E:1877678..1878310
Genome map
AA seq 210 aa AA seqDB search
MSVEEVTQKTQDLTVDEAKPATVLSDPKEFQLKHPLSSKWTLWYTKPPVDSSESWSDLLR
PVTSLDTVEEFWAIQNGIPKPFDLPIKSDYHLFRNDIRPEWEDEANSEGGKLSYQFKNKR
HNIDDLWLRTLLAVIGETIDEEESEINGCVLNVRKAVFKIALWTRTTNLNALTNIATKFK
QVLQLGEGEKLEFYNHRTSNSGHAPPTALL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgaagaagttactcaaaagacccaggatttaactgtggacgaagccaagcca
gctactgttttatctgatcctaaggaatttcaattgaagcatcctttgagtagcaaatgg
actttatggtatactaagccccctgtggatagttcagaatcgtggtctgatttattgcgt
ccagtgaccagtttggatactgtcgaagagttctgggctattcaaaatggtattccaaag
ccattcgatttgccaatcaaatctgattaccatttgttcagaaacgatatcagacctgaa
tgggaagatgaagccaactctgaaggtggtaagttgtcgtaccaattcaagaacaaaaga
cataacatcgatgatttgtggttgagaactctattggccgttattggtgaaaccatcgac
gaagaagaatcagaaatcaacggttgcgtcttgaatgtcagaaaggctgttttcaagatt
gctttgtggactagaactaccaacttgaacgctttgactaacattgctaccaagtttaag
caagttctacaacttggtgaaggtgaaaagttggagttctacaatcacagaacttctaac
tcaggtcacgctcctccaaccgctctattgtaa

DBGET integrated database retrieval system