KEGG   Kluyveromyces lactis: KLLA0F01056gHelp
Entry
KLLA0F01056g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
kla  Kluyveromyces lactis
Pathway
kla03022  Basal transcription factors
kla03420  Nucleotide excision repair
Module
kla_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    KLLA0F01056g
  Replication and repair
   03420 Nucleotide excision repair
    KLLA0F01056g
Transcription machinery [BR:kla03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     KLLA0F01056g
DNA repair and recombination proteins [BR:kla03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     KLLA0F01056g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 2895859
NCBI-ProteinID: XP_455127
UniProt: Q6CLR2
Position
F:complement(96166..97656)
Genome map
AA seq 496 aa AA seqDB search
MSLNLFKTTVNDYLEGLPEQVQSRLYESPATCLAIYRLLSPMAKFFIMSMLFQDHDVSLR
DLDKWVKPDAKYQLQYSIKSMKSLNLIIEGESKQPLLIRLNPIFKKSFKNVLTGGEINNS
FGDVADDDTNPVSTATLDQYSAEKWETILHYMVGTPNTNTPGGKVLDLLQHSGLMEEAEY
GELKITNQGFQFLLQDVNAQMWTLLLQYLKMAESLQMDPVDVLNFIFMLGALQLGKAYKC
DQLSNTQRTMLQDMRDYGLIYQNQSDYAKFYPTRLATLLTSDTKAFRSASVALDSVLNKA
NETTAVEGDSGQDETTERTQDGALIIETNFKLYSYSNSPLQIAILSLFVHLKSRFANMVT
GQLTRESVRNALLNGITAEQIIAYLETHAHPRMRRLAEENLSKKLELDPTVKETLQVLPP
TVVDQIRLWQLELDRIISYDGYLYTDFESYQEYQTVADYAKDIGVLLWQNEKKKMFFVST
EGNSQVLDFHRRNFDK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaatcttttcaagaccaccgttaatgactacctagaaggtcttccagagcaa
gtccaatcaagattatatgagtctccagcgacatgtttggcaatttatagattgctttct
cccatggcaaaattcttcattatgtcgatgctgtttcaggaccacgatgtctcgcttaga
gatttagataaatgggtcaagccagatgcgaaataccagttacaatactctattaaatcg
atgaaatccttgaatcttataatagaaggtgagagtaaacaacctctattgattcgtttg
aatccaattttcaagaaatctttcaaaaatgtattaactggtggtgaaatcaataactct
tttggtgatgttgcggatgatgataccaatcccgtatctacagctactttggaccagtat
agtgcagaaaagtgggaaacaatcttgcattacatggtgggaacaccgaatacaaacact
cctggtggaaaggttctagacttattgcagcatagtggtctaatggaagaggcagaatat
ggcgaactcaaaattactaaccaaggtttccaatttctcttgcaagatgtcaatgcacag
atgtggactcttcttcttcaatatttgaagatggcagaaagtttacagatggatcccgtg
gatgttctaaatttcattttcatgctaggtgcattacagctagggaaggcgtataagtgc
gatcaactaagtaatacgcagagaacaatgttacaggatatgagagattacggattaatc
tatcaaaatcaatcggattatgcaaagttttatcctaccagattagccacgttgttgacg
tccgacacaaaagcattcagaagtgcctcagtcgctctagacagcgtgttaaataaagct
aatgaaacaacagctgtagaaggagacagtggacaagatgaaactacagagcgaactcaa
gacggtgccttgattatagagactaacttcaaactatattcatattctaactccccattg
caaattgctattctatcgctatttgtccatctaaaatcaagatttgcgaatatggtgact
ggacagcttacgagagaatctgtaagaaatgctttattgaatggtattactgcagaacaa
attatagcataccttgaaactcatgctcacccgagaatgaggcgattggcagaagagaat
ttgagtaaaaaattagagttagaccccaccgtgaaggagacccttcaggttttacctcca
accgttgttgaccaaatacgattgtggcaacttgagttggatagaatcataagttacgat
ggatatctatacacagatttcgagtcctaccaagaataccaaactgtagcagattatgca
aaggatattggtgtactactctggcaaaacgagaagaagaagatgttctttgtgtcaact
gaaggcaattcacaggtgctagacttccacagaagaaattttgataagtag

DBGET integrated database retrieval system