KEGG   Kluyveromyces lactis: KLLA0F16929gHelp
Entry
KLLA0F16929g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
kla  Kluyveromyces lactis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 2894947
NCBI-ProteinID: XP_455841
UniProt: P32556
Position
F:complement(1558278..1558610)
Genome map
AA seq 110 aa AA seqDB search
MPAPYKKGSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRHSGKASGYSYTDANI
KKNVLWDEQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDIVTYMLKACK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacaagaagggttccgaaaagaagggtgctactttgttcaagaccaga
tgtttgcaatgtcacaccgttgaagccggtggtccacacaaggtcggtccaaatttgcat
ggtgtcttcggtagacactctggtaaagcttccggttactcttacactgacgctaacatc
aagaagaacgtcttgtgggatgaacaaactatgtctgactacttggaaaacccaaagaag
tacattccaggtaccaagatggctttcggtggtttgaagaaggaaaaggacagaaacgat
atcgttacttacatgttgaaggcttgtaaataa

DBGET integrated database retrieval system