KEGG   Kluyveromyces lactis: KLLA0_A05544gHelp
Entry
KLLA0_A05544g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kla  Kluyveromyces lactis
Pathway
kla00010  Glycolysis / Gluconeogenesis
kla00030  Pentose phosphate pathway
kla00051  Fructose and mannose metabolism
kla00052  Galactose metabolism
kla00680  Methane metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01200  Carbon metabolism
kla01230  Biosynthesis of amino acids
kla03018  RNA degradation
Module
kla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0_A05544g
   00030 Pentose phosphate pathway
    KLLA0_A05544g
   00051 Fructose and mannose metabolism
    KLLA0_A05544g
   00052 Galactose metabolism
    KLLA0_A05544g
  09102 Energy metabolism
   00680 Methane metabolism
    KLLA0_A05544g
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    KLLA0_A05544g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kla01009]
    KLLA0_A05544g
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:kla03019]
    KLLA0_A05544g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KLLA0_A05544g
Protein phosphatases and associated proteins [BR:kla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KLLA0_A05544g
Messenger RNA biogenesis [BR:kla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KLLA0_A05544g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Pfk_N DAGK_cat
Motif
Other DBs
NCBI-GeneID: 2896656
NCBI-ProteinID: XP_451245
UniProt: Q03215
Position
A:510371..513349
Genome map
AA seq 992 aa AA seqDB search
MNNSVYGVAFRSLSTGDEKLYKEATRFYHSLGFQTVKLYDNFKNHDDSNLIVGTSKNSVK
ECWLESFKLSELDSQGFRVPQQEASNQLQTDGVMIKLRLVDTEPLNQTADTVVYYTVSLD
EVSKIGERVDDHNVKLVDPLGNVVLVTDSHDGKELNASEFIAPKDSSVEQKITVELVDKD
SKKKKIAVMTSGGDSQGMNAAVRAVVRSSIYYGCDVYAVYEGYEGLVKGGDYLRKMEWKD
VRGWLSEGGTLIGTARSKEFRERWGRKQACSNLIDQGIDALVVIGGDGSLTGADLFRSEW
PSLVEELVKDGKFTEDEVALYQNLTIVGMVGSIDNDMSGTDSTIGAYSALERICEMVDYI
DATAKSHSRAFVVEVMGRHCGWLGLMSGIATAADYIFIPERAAPHGKWQDELKRVCQRHR
EKGRRNNTVIVAEGALDDQLNPITAEQVKDVLVELGLDTKITTLGHVQRGGTAVAHDRWL
ATLQGVDAVKAILNMTPETPSPLIGILENKVIRMPLVESVKLTKQVAAAIEAKDFDKAIS
LRDTEFIELYSNFMSTTVNDDGSQLLPEADRLNIAIVHVGAPSAALNAATRAATLYCLAH
GHRPYAITNGFSGLIQTGQVKELSWIDVEDWHNLGGSEIGTNRSVAAEDMGTIAYHFQKN
KFDGVIILGGFEGFKSLKQLRDGRDQYPIFNIPMCLIPATVSNNVPGTEYSLGSDTCLNA
LVKYTDAIKQSASSTRRRVFVVEVQGGHSGYVASFTGLVTGAVSVYTPENAINLKTIQED
LALLKESFKHEQGETRNGKLVIRNEMASDVYTTELLADIITEQSNDRFGVRTAIPGHVQQ
GGVPSSKDRVIASRFAVKCVKFIEQWNKKNTAADNEDFKILRFNYVNGVKQYTVLDEDLS
AAVICVNGSKISFKPIAHIWENETNIELRKGQEIHWEEYNEIGDILSGRSMLRRKIQKEQ
QEESSLPSVADTPLSSVTVSTSAAKEDSALYV
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcggtctacggcgttgctttccgttcattgagtaccggtgatgaaaagctg
tataaggaagctacgagattctaccattctttgggtttccaaacggtaaaactgtacgat
aattttaagaaccatgacgattcgaatttgatcgttggtacttccaagaactctgttaag
gaatgttggttggaatcgttcaagttgtctgaacttgattcacaaggtttcagagttcca
caacaggaggcttctaatcagctacaaactgatggtgttatgatcaagttgaggttagtg
gacactgaacccctaaatcaaactgccgatacagttgtgtattacaccgtcagtttggat
gaagtatccaagattggtgaaagagttgatgatcataacgtcaaattagtggatcctttg
ggtaacgtggttcttgtcactgattcccatgatggtaaggaattaaacgcttcagagttc
atcgcacctaaggattcttcagtagaacaaaagatcactgtagaattagtggataaggat
tccaagaaaaagaaaattgccgtgatgacatctggtggtgattctcaaggtatgaatgcc
gctgtccgtgcagtggttagatccagtatctattatggatgtgacgtttatgcagtttac
gaaggttatgaaggtttggtgaaaggtggagactatttgagaaaaatggaatggaaggac
gtccgtggatggctcagtgaaggtggtacattaattggtaccgctcgttccaaggagttc
agagaaagatggggccgtaagcaagcttgttctaatttgatagatcaaggtatcgacgct
ttggttgtaattggtggtgacggttcactaactggtgcagacttgttcagatccgaatgg
ccatctctagttgaagaactagtgaaggacggtaagtttactgaggacgaagttgctcta
taccaaaacttaaccattgttggtatggtcggctccatcgataacgatatgtctggtact
gattctaccattggtgcttactctgctttggaaagaatctgtgagatggttgattacatc
gacgctactgctaagtcacattcaagagcatttgttgtggaagtgatgggtaggcattgt
ggttggttaggtctaatgtctggtatcgctaccgcggctgattacattttcattccagag
agagcagctcctcacggcaaatggcaagatgagttgaaacgtgtttgtcaaaggcataga
gaaaagggtcgtagaaataacacagttatcgttgcagaaggtgcattggatgatcaatta
aacccaattaccgccgaacaagttaaggatgtcttggtagaacttggtttagacaccaaa
atcactacattgggacacgttcaaagaggtggtacagctgtggcacatgatagatggtta
gctactttgcaaggtgttgatgctgtcaaggccatcctgaacatgactccagagactcca
tctccattgattggtattctcgaaaataaggttatcagaatgcccttggttgaatctgtg
aaactcacaaaacaagttgctgcagccatcgaagctaaagatttcgataaagccatttct
ttacgtgacacagagttcattgaattgtattccaacttcatgtccaccaccgttaatgat
gatggatctcagctattgcctgaagcagacagattgaacatcgccattgttcacgttggt
gcaccttctgctgctttgaacgcagccactagagcagcaacattatactgtctagctcat
ggtcatagaccatatgctattacaaatggtttcagtggtctaatacaaacaggtcaagtg
aaagaactttcctggatcgatgttgaagactggcataacctcggtgggtcagaaattggt
accaatagatccgtcgcagcagaagatatgggtactatcgcataccatttccaaaagaac
aagtttgatggtgtcatcatccttggtggatttgaaggtttcaagtctttgaagcaatta
agagatggtcgtgaccaatatccaatcttcaacattccaatgtgtttgatcccagccacc
gtgtccaacaacgtgcctggtacagaatactctttgggttccgatacctgtttgaatgcg
ttagtgaagtacaccgatgctatcaaacaatctgcatcatctaccagacgtagagtgttc
gttgttgaggttcaaggtggacactccggttacgttgcatctttcactgggctagttacc
ggtgctgtctctgtttacactccagaaaatgctattaacttaaagactattcaagaagac
ttggcattattgaaggaaagtttcaaacatgagcaaggtgaaaccagaaacggtaagctt
gtaatcagaaacgaaatggcctctgatgtctataccacggaattgcttgcagatatcatc
actgaacaatcaaatgacagatttggtgtcagaaccgctattccaggtcatgttcaacaa
ggtggtgtaccatcctccaaggatcgtgtcattgcatccagattcgctgtgaagtgtgtc
aagttcatcgaacaatggaataagaagaacaccgctgcagacaatgaggatttcaagatc
ctacgattcaattacgtgaacggtgtgaagcaatacactgtccttgacgaagatctatct
gccgctgtgatttgtgtcaatggttccaagatttctttcaagccaatcgctcatatctgg
gaaaacgaaaccaatatcgaactcagaaagggacaagaaattcactgggaagaatacaac
gagatcggagatattctttccggcagaagtatgctaagaagaaagatccaaaaggaacaa
caagaagaatcctctttaccaagtgtggcagacactccattgtcatctgtcacagtttct
acctctgctgcaaaagaagactcagccttgtatgtttaa

DBGET integrated database retrieval system