KEGG   Kluyveromyces lactis: KLLA0_B05489g
Entry
KLLA0_B05489g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
kla  Kluyveromyces lactis
Brite
KEGG Orthology (KO) [BR:kla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kla01009]
    KLLA0_B05489g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     KLLA0_B05489g
Protein phosphatases and associated proteins [BR:kla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     KLLA0_B05489g
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 2897312
NCBI-ProteinID: XP_451780
UniProt: Q6CWA9
Position
B:488386..490023
AA seq 545 aa
MSQEAIENTKKVNAALRVIESKPSVRDDKDLDLTEYELEDGVKRSTVERVVKSVPPVAAR
VPTDEELFKPDGLPNHEFLKKHFLKEGRLSRDQTKRILEMVIDVFAKEPNLLMLNSPLTI
CGDIHGQYYDLMKLFEVGGDPSETPYLFLGDYVDRGSFSFECLIYLYALKINFPKTFWLL
RGNHECKHLTSYFTFKAECLHKYDLSIFDACCKSFNYLPLAAVMNNQYFCTHGGISPDLV
SVQDVNKINRFREIPSKGLMCDLMWADPIENYDEDSNSEERFVPNSLRGCSYAFTYKAVC
DFLKRNGLLSVIRAHEAQDQGYRMYKNTKSMGFPSLMTLFSAPNYLDTYKNKAAILKYGD
NLMNIRQFNFSPHPYWLPNFMDVFSWSLPFVGEKVTEMLIAILNICAEEELDEDVPIIDE
AVGKISEVDDGVNEKESPRSNILDEAKRRSLRNKIMAIAKVSRMYSVLREESEKVQYLKT
INSGTLPKGALAHGAEGLTETLSEFEKARKQDLINERVPPKMEEMESEREKYYRDMLQKI
KGDQI
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgagtcaggaggctatagagaataccaagaaagttaatgcagctctgcgagtcattgag
tctaagccttcagttagagacgataaggatttagatttgacggagtatgaattagaagac
ggtgtgaagcgatctactgtagaaagggtggtaaagagcgtaccgccagtggcagccagg
gtaccaacggacgaggaattgttcaagccggacggattaccaaaccatgagtttttgaag
aaacacttcctcaaagaaggacgactatcacgtgatcaaaccaaaaggattctagagatg
gtgatagacgtatttgccaaggaaccgaatctgttgatgctgaattcgccattgactatt
tgtggtgacatccatgggcaatattacgatcttatgaaattatttgaagtcggaggagat
cctagtgagacaccgtatctatttttaggtgattatgtggatagaggctcattctcattt
gaatgtttgatctatttgtatgcgttaaagatcaacttccctaagacattctggttgtta
cgtgggaaccacgagtgtaaacatttgacatcatatttcactttcaaggctgagtgtttg
cacaagtacgatttatccatctttgatgcttgttgcaaatcgttcaactacttaccccta
gctgcagtgatgaacaaccaatatttctgtacgcacggtggtatttctccagatttggtc
tccgtacaagatgttaacaagataaatagatttagagagatcccttcaaagggtttgatg
tgtgatttgatgtgggcggacccaattgaaaattatgatgaggattctaattccgaggag
agatttgtaccaaactcgttaagaggttgttcttatgcattcacttataaagctgtatgt
gattttttgaaaagaaacggattgttgtcagtgatacgagctcatgaggcccaagaccaa
ggatatagaatgtacaaaaataccaaatcgatggggttcccaagtttaatgacccttttc
agtgccccaaactacttggatacttacaagaacaaggcagctatattgaaatatggagat
aacctaatgaatatcagacaatttaacttttcaccgcatccatattggctacccaacttt
atggatgtgtttagctggtctttacctttcgtcggagaaaaagtcaccgaaatgttaatt
gcaattttgaacatttgcgcggaggaagaattggatgaagatgtgccgattattgatgaa
gctgtgggaaaaatatccgaggttgatgatggtgtaaatgaaaaggaatctccacgttct
aacattcttgatgaagccaaacgcagatctttaagaaacaaaatcatggcgatcgctaaa
gtgtcaagaatgtacagcgttctacgagaagaaagcgaaaaggtccaatatttgaaaacg
atcaattcaggtactttaccaaagggtgctttagctcatggtgccgaaggtctaacagaa
actttaagcgaatttgagaaggctaggaagcaagatctcatcaacgaaagggtaccacca
aagatggaagaaatggaatctgagagagaaaagtactatagagatatgttacaaaagatt
aaaggtgatcaaatatga

DBGET integrated database retrieval system