KEGG   Kluyveromyces lactis: KLLA0_B09064gHelp
Entry
KLLA0_B09064g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla00010  Glycolysis / Gluconeogenesis
kla00071  Fatty acid degradation
kla00350  Tyrosine metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0_B09064g
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KLLA0_B09064g
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    KLLA0_B09064g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KLLA0_B09064g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 adh_short Epimerase BKACE
Motif
Other DBs
NCBI-GeneID: 2897174
NCBI-ProteinID: XP_451932
UniProt: P49384
Position
B:complement(792849..793973)
Genome map
AA seq 374 aa AA seqDB search
MLRLTSARSIVSPLRKGAFGSIRTLATSVPETQKGVIFYENGGKLEYKDIPVPKPKPNEI
LINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWL
NGSCMSCEYCELSNESNCPDADLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILC
AGVTVYKALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMGYRVVGIDGGEEKGKLVKQL
GGEAFVDFTKTKDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPTGTVVLVGLPAG
AVIKSEVFSHVVKSINIKGSYVGNRADTREAINFFANGHVHSPIKVVGLSELPKVYELME
QGKILGRYVVDTSN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgttgagattgacttccgccagatccattgtttccccattgcgtaagggtgcttttggt
tccatcagaaccttagctacctctgtgccagaaacccaaaagggtgttattttctatgag
aatggtggtaaattggaatacaaggacattccagttccaaagccaaagccaaatgaaatc
ttgatcaacgtcaagtactccggtgtgtgtcataccgatttgcacgcatggaagggtgac
tggccattgccaaccaagttgccattggtcggtggtcacgaaggtgctggtgtcgttgtt
gctatgggtgaaaacgtcaagggctggaacattggtgactttgcgggtatcaaatggttg
aacggttcttgtatgtcctgtgaatactgtgaattgtccaatgaatccaactgtccagat
gctgacttgtctggttacacccacgatggttctttccaacaatacgctaccgcagatgct
gttcaagctgccagaattccaaagggtaccgatttggctgaagttgctccaattctatgt
gccggtgttactgtttacaaggctttgaaaagtgctaacttgaaggctggtgactgggtt
gccatctctggtgctgctggtggtctaggttctctagctgtccaatacgccaaggccatg
ggttacagagtcgttggtatcgacggtggtgaagaaaagggtaagttggtcaagcaattg
ggtggtgaagcctttgttgatttcaccaaaaccaaggacatggttgctgaaatccaagaa
atcaccaacggtggtccacacggtgtcattaacgtctctgtttctgaagctgccatgaac
gcttccactcaattcgtcagaccaactggtactgtcgtattggtcggtttgccagctggt
gccgtcatcaagtccgaagtcttctcccacgtcgttaagtctattaacatcaagggttct
tacgtcggtaacagagctgacaccagagaagctatcaacttcttcgctaacggtcacgtc
cactctccaatcaaggttgttggtttgtccgaactaccaaaggtttacgaattgatggaa
caaggtaagattttgggtagatacgttgttgacacctccaactag

DBGET integrated database retrieval system