KEGG   Kluyveromyces lactis: KLLA0_C12265g
Entry
KLLA0_C12265g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
kla  Kluyveromyces lactis
Pathway
kla00100  Steroid biosynthesis
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
Module
kla_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    KLLA0_C12265g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     KLLA0_C12265g
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 2892474
NCBI-ProteinID: XP_452744
UniProt: Q6CTJ5
Position
C:complement(1041161..1042486)
AA seq 441 aa
MSLATMTALNPKTTHYEFSGPVGALLISVFLPILTVILNQLIRPDYHIVGLFRNFSWIEV
WNKVNPLSSYLFNGELWTYYSAWFFSLAVLDVLLPGTKLYGVELRDGSKLPYKINGIAVS
MALTLVLAVRYQLTNGEMPELQYLFEHQTDICIISILFSFLLACFVYIGSFVPLWGTNGK
GTKERILAVGGNSGNILYDWFIGRELNPRIGPLDIKMFAELRPGMLLWFLINLSCLHHSY
RESGKIYDSLLLVNVLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYCL
QARYLAVSPIEFGLPHSTLIVIIMLLGYWIFHSANKQKSDFRQGKLPQLKSIQTDKGTKL
LCDSWWAVSQHINYFGDLLISLSWCLATGFQTPLTYYYFFYFAALLLHRQSRDEEKCRNK
YGVFWEEYERKVPYKIVPYVY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtccttagcaacaatgacagctttaaatcctaagaccactcattatgagttttctgga
ccggtcggagcccttctgatttcagttttcttacccattctaactgtcatcttgaaccag
ttgatcagacccgactatcatatcgtagggctattcagaaactttagctggatcgaagtt
tggaacaaggtaaatccattatccagttatctcttcaatggtgagctttggacttattac
tctgcatggtttttctctctagcagttttggatgttctcttaccaggcacgaaactctac
ggtgtcgagttgagagatgggtctaagctaccatataagattaacggaattgccgtgtca
atggcacttactttagttttagctgtcagatatcaattgactaatggtgaaatgcctgaa
ctacagtatttattcgaacatcaaacggacatctgcataatatctatattgttttctttc
ttgttggcttgcttcgtctatattggcagtttcgtgccattatggggaacaaatggcaaa
ggaactaaagaacgtattcttgctgtggggggcaacagtgggaacattttgtatgattgg
ttcattggaagagagttgaatcccagaattggtcctcttgacatcaagatgtttgcagaa
ttaagaccgggtatgttgttatggtttttgatcaatctctcatgcttacaccacagctat
agggaatctggtaaaatttatgactctttgttattggtaaatgttctacagggtttctat
atctttgatggggttttgaatgaggaaggggtgttgacaatgatggatatcactactgat
ggctttggattcatgctagcttttggcgatttgagtttggttcctttcacttactgctta
caggctcgatatttagctgtctcaccaattgagtttggcctgccccatagtacgttgatt
gttattataatgttactaggttattggattttccattctgcaaataagcaaaagtcagat
ttcagacaaggaaagctaccgcaattaaaatccatccaaactgataaaggaacaaaatta
ttatgtgattcttggtgggctgtttcccagcacattaattattttggtgatttgttgatt
tctctgagttggtgtttggccacgggattccaaaccccactaacgtattattatttcttc
tactttgctgcattactgttgcatagacaaagtagagacgaagaaaagtgcaggaataag
tatggtgtattctgggaagagtatgaaagaaaagtaccatacaaaattgtcccttacgta
tattaa

DBGET integrated database retrieval system