KEGG   Kluyveromyces lactis: KLLA0_C13057gHelp
Entry
KLLA0_C13057g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06646  G1/S-specific cyclin CLN3
Organism
kla  Kluyveromyces lactis
Pathway
kla04111  Cell cycle - yeast
kla04113  Meiosis - yeast
Module
kla_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:kla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLLA0_C13057g
   04113 Meiosis - yeast
    KLLA0_C13057g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 2891919
NCBI-ProteinID: XP_452782
UniProt: Q6CTF7
Position
C:complement(1109343..1110593)
Genome map
AA seq 416 aa AA seqDB search
MMSNLTMVDSNYMNCIRRSIWNEKASNPNLIEMELKSHKATINENASTIFSRLVENESST
TVSMKCFKSQPEINFQMRSLIFDFIMCCHIRLKLSTPTLFLCFNIIDRYCSKIIVKSSTY
QLLGLCSLWLASKYTDKKQKIPSLPTLQSLCCNQYTKEQFKEMELHICQSLNWTMCHGPS
LDSFLDILVRGNTFQNNETDCSAMKLGALILCQLCCFNPTLSFTNSSSSIALACLSITKY
ALLSSKFNTFVNFETMMSNDKPDPKLINLMKSILEVINVADIPSSFKLRYYVNDVQHPIL
KCLFSYKTYWKDHLSRIEYSTLMSPLVPDYNHKDRLSPKSLQMDSMRWMQIPPTPTTTPS
TPTLAKSSRPSLPTSSSHHPSGSFRRHFKRDSSTMDIDFFEQEPIQHVKRGKVGEC
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcaaatctgaccatggtagattcaaactatatgaattgcataagaaggtcgatt
tggaatgagaaagcttctaatccaaatttgattgagatggaattgaaatctcacaaagct
acgattaatgaaaatgcatccacaatcttctctagattggttgaaaatgaatccagcaca
acagtttctatgaaatgttttaagtcccaacctgaaatcaattttcaaatgagatccttg
atttttgatttcatcatgtgctgtcacatcagattgaaactttcaacaccaactcttttc
ctatgttttaatattatcgatagatattgttctaaaatcatcgtcaagtcttctacttac
caacttttaggtttatgttctctatggttggcatctaaatacacggacaaaaagcaaaaa
attccttcattacctactttacaaagcttatgttgcaaccaatataccaaagagcaattc
aaggaaatggaacttcacatttgtcagagtctcaactggacaatgtgtcacggacccagt
ttggattctttcttggatatcttggtaaggggaaatacgttccaaaacaacgaaacagat
tgttctgccatgaaacttggagcgttgatactatgccagctttgttgcttcaacccaacc
ctctcattcactaactcttctagctccattgctctggcgtgcttatctatcacgaaatat
gcactattgtcctccaagtttaatacctttgttaacttcgaaacaatgatgtccaatgac
aaaccagacccgaaactaatcaatctaatgaagtccatattggaagtaatcaacgttgct
gatattccatctagtttcaagcttaggtattatgtcaacgatgttcagcatccaattttg
aagtgtctattctcctataagacatattggaaagatcacttgtcaagaattgaatattct
acattgatgtccccattggtaccggattacaatcataaagatcgtctgtccccaaaatca
ctccaaatggattcaatgagatggatgcaaatcccccctactcctacgactactccctcc
acaccgacattggccaaatcctccaggccgtcattaccaacatcatcgtcacatcacccg
agcggatcgttcagaagacatttcaagagagattcatcaaccatggatatcgatttcttc
gaacaagagcccatccagcatgtcaaaagagggaaagttggagaatgttaa

DBGET integrated database retrieval system