KEGG   Kluyveromyces lactis: KLLA0_D03432gHelp
Entry
KLLA0_D03432g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08712  ATP-binding cassette, subfamily G (WHITE), member 2, SNQ2
Organism
kla  Kluyveromyces lactis
Pathway
kla02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kla00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KLLA0_D03432g
Transporters [BR:kla02000]
 ABC Transporters, Eukaryotic Type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    KLLA0_D03432g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC_tran PDR_CDR ABC2_membrane_3 RsgA_GTPase AAA_16 AAA_22 ABC_trans_N AAA_29 AAA_33 AAA_25 AAA_18 MMR_HSR1 AAA_17 cobW Septin NACHT SMC_N AAA_24 TsaE
Motif
Other DBs
NCBI-GeneID: 2892730
NCBI-ProteinID: XP_453219
UniProt: Q6CS70
Position
D:287805..292256
Genome map
AA seq 1483 aa AA seqDB search
MEGSNNGLSSRPEKLDGDPRSTSDTSSSGSCTSLKEFSGNNHELHQDTDQQVVKDAAEDP
AFLKKVETLSRSLSRRTTTLSEWDEVDENFDMYREIQGILKASNDGGIHLRKAGITARNV
AVKGVDAQFLEGATYGDMLMLPATIFKGIKKARQTTLRDIISNVNLLVRPGEMLLVLGRP
GSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYFKSDVIYNGEMDVHFPHLTVQQ
TLDFAVACKTPSKRINDFTRQQYIEFIRDLYATIFGLKHTYNTKVGDDFVRGVSGGERKR
VSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTALITVYQASENIYET
FDKVTILYEGKQIYFGRIEEAKKYFENLGFICPARQATAEFLTSLTDSKGLRRVRPGFEN
KVPRTRDDFVRVWEESKEYHDLIQSIEHYETKEVDGAKTIQFFKESMVEEKDKASRKKSK
FTISYWAQIRLCTRRGFQRIYGDKSFTITNTVAAIIQALVTGSLFYNTPSSTQGAFSRGG
VLYFAILYFSLMGLANISLANRPILQKHIAYSLYHPSAEALASTISNAFFRMISLTAFLI
ILYFLSGLTRNAGRFFMVYLFVALASESINALFEFITAACDSISQANAIAGLVMMALSLY
STYMIQTPSMHPWFEWISYILPLRYAFENMLNAEFHARRMDCGGTLVPTGPVYENVSSEY
KVCAFIGSQPGESYVLGDNYLKLQYDYSYSHQWRNFGILIAFLVGFLVFKSVITEFKTPI
KSSGDALLFKKGTSLNTIPKDEESNVNSTDSITKTTDSSSRSDDPALFADMRSEGIFLWK
DICYTIPYKGGERLLLDNVSGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIGVVTGDML
VNGKPIDASFERRTGYVQQQDVHIKEMTVRESLQFSARMRRPLTVPDEEKLDYVEKVIEI
LDMSAYGEALVGNIGYGLNVEQRKKLSIAVELVAKPNLLLFLDEPTSGLDSQSAWAIVQL
LKKLAGAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFGDIGEHSSTLLSYFERNGA
RRCEEKENPAEYILEAIGAGATASVKEDWHEKWIKSSEFVSVNQEINDLIEKLAHQPNDD
SSTELITKYATPYWYQFVYVLRRTMVMFWRDVDYLMAKTMLYISSGLFIGFTFYNVGTSF
VGLQNAMFAAFMACIVSAPAMNQIQARALQSRELYEVRESRSNMFHWSCMLFSQYITELP
YQLWCSTLFFVSFYFPLKAEYTSLKAGLFYLNYCVIFQLYCVGLGLAVLYMSPDLPSSNV
IMGLLLSFMITFCGVVQPVNLMPGFWTFMWKVSPYTYLIQNFVSLMLHDKTVICTDKELS
YFNPPPGSTCGSYMTDYFTEGFGYIKNPEATSNCAYCRYKIGDQYLSYISAKYADLWRNF
GFLWVYICFNLIAMVSLYYIFHVKRFSPKSLVMGVVGKFKKEK
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
atggagggttcaaacaatggattgagcagtcgtcctgagaaattggacggagatcctcga
tcaactagtgataccagcagcagtggtagttgtacttctctgaaagagttcagtggtaac
aaccatgaacttcatcaggatactgaccaacaggtagttaaggatgctgctgaggatcca
gcgtttctgaaaaaagtagagactctttctaggtcattgtcccgtcgtactacgactctt
tctgagtgggatgaggtcgatgagaacttcgatatgtacagagagatccaggggatcctt
aaggcgtccaacgatggtggtatccatttgaggaaggccggtatcaccgccagaaacgtt
gctgtaaagggtgttgacgctcagtttcttgaaggtgccacttacggtgatatgctaatg
ttacctgcaactatattcaagggaattaagaaggccagacaaacaacattgagagatatc
attagcaatgtaaatctacttgttaggcctggtgagatgttgcttgtattgggtagacca
ggttctggttgttccactttcttaaaaacaatggctggtgagctatctcatttcaagggt
gtctcaggtgacatctcgtacgacggtgtctcacaaaaggatatgttgaagtatttcaag
tcggatgttatatacaacggtgaaatggatgtccatttcccgcatttgactgtgcaacag
actttagattttgctgtcgcttgtaagactccaagcaaaagaattaacgattttaccaga
caacagtatatcgaattcatcagagacttatatgcaacaattttcggtttgaagcacact
tataacactaaagttggtgatgatttcgtgagaggtgtctctggtggtgaacgtaagcgt
gtttccatcgcagaagctttggccgctcgcggttccatatattgttgggataacgctact
cgtggtctcgatgcttctactgctcttgaatatacagaagctatcagatgtatgacaaac
ttactaaagtccactgcgttgattactgtgtaccaagcaagtgaaaacatctatgagact
ttcgataaggttaccattctctacgaaggtaaacaaatatatttcggtcgcattgaagag
gctaagaagtatttcgaaaacttggggttcatctgtccagcaaggcaagcaacggctgaa
tttttgacctctttaactgattctaaaggtttacgcagagtaagacctggtttcgaaaac
aaagtcccaagaaccagagacgatttcgtcagggtttgggaagagtccaaagaatatcat
gacttaatacaaagtatcgaacattacgaaacgaaagaagtcgatggtgcgaagactatc
cagttcttcaaagaatcgatggttgaagagaaagataaggcttcgagaaagaagtctaaa
tttactatttcctattgggctcaaatcaggctctgtaccaggagagggttccaaagaatt
tatggtgataagtcttttactatcacaaacactgttgctgctatcattcaagccttggtt
actggttccctattctacaacaccccaagtagtactcaaggtgctttctctcgtggtggt
gttttatatttcgctattctatatttctctttgatgggtttagccaacatcagtttagca
aacagacctatcttgcagaaacatatcgcttactcattgtatcatccatctgctgaagca
cttgcttctactatctctaatgccttcttcagaatgatttcgttaaccgctttcctaatc
atcctttacttcttatctggtttgactcgtaacgctggcagattcttcatggtgtatttg
tttgtggcgctcgcatccgagtcaatcaatgccttgtttgaatttatcactgctgcgtgt
gactcaatttctcaggctaatgctattgcaggtttggtgatgatggccttatccttatac
tccacctatatgattcaaactccttctatgcatccatggtttgaatggatctcttacatt
ctaccattgagatatgcttttgagaacatgctaaacgctgaatttcatgcaagaaggatg
gattgcggtggtactttagtaccaacgggtcctgtttacgagaatgtcagtagtgaatac
aaggtctgtgcgttcatcggatctcagccaggtgaatcgtatgttttgggtgataactat
ttgaaacttcagtacgactactcatattcacaccaatggagaaatttcggtattttgatc
gcatttttggtcggtttcctcgtcttcaagtctgttatcactgaattcaagacccctatt
aagagtagtggtgatgctttactcttcaaaaagggtaccagcttgaacaccattccaaaa
gacgaagaaagcaatgttaacagtactgattccattacgaagaccactgatagctcatct
aggtcggacgacccagcactatttgctgatatgagaagtgaaggtatcttcctatggaag
gatatctgttatactatcccttataaaggcggcgaacgtctgttattggataacgtatct
gggtatgttaaacctggtactttgactgccttgatgggagaatctggtgcaggtaaaact
acattgctaaacacacttgctcaaagaactgacattggtgttgtcactggtgacatgttg
gtaaatggtaagccaatcgacgcctcattcgaaagaagaacgggttacgttcaacaacaa
gatgttcacatcaaagaaatgacagtcagagaatctctacaattctcagcaagaatgaga
agaccactaactgttccagatgaagaaaaacttgattacgttgaaaaggttattgaaatc
ttggacatgtccgcttacggtgaagctttagtcggtaatattggttatggtttgaacgtt
gagcaaagaaagaagttatcaattgctgttgaattggttgccaaaccgaacttgttgttg
tttttggacgaaccaacttctggtttagattctcaatctgcctgggccattgttcagttg
ttgaagaaattagccggcgccggtcaatcaattttgtgtaccatccatcaaccttctgct
actttgttcgaagaattcgacagattgttattattgcgtaaaggtggtcaaactgtgtac
tttggtgacatcggtgaacactcttctacgttgttatcatactttgagagaaatggtgca
cgtaggtgtgaagaaaaggaaaatccggccgagtatattttggaagccattggtgccggt
gctacagcttccgttaaggaagattggcacgaaaaatggattaaatcatcagaatttgtt
tctgttaaccaagaaatcaacgacttaatcgaaaagctagcccaccaaccaaatgacgat
tcttccactgaattgattactaaatatgctacaccatattggtaccaattcgtttatgtt
ttaagacggaccatggttatgttctggagagatgtggactacttaatggctaagaccatg
ttgtatatcagcagtggtttgttcatcggtttcaccttctataatgtgggtacttctttc
gtcggtctacaaaatgcgatgtttgctgcatttatggcttgtattgtttctgccccagca
atgaatcaaattcaggctcgtgccctacaatcaagagaattatatgaagttagagaatcc
agatctaacatgttccactggagttgtatgttgttctcacaatatatcactgaattaccg
taccaattatggtgtagtaccttattctttgtatccttctatttcccattgaaggcagaa
tacacaagtttgaaagccggtttattctacttgaactactgtgtcattttccaattatac
tgtgttggtttgggtttagctgtgttgtacatgtctccagatcttccaagttcaaacgtc
attatgggtttactactctccttcatgattaccttctgtggtgttgtgcaacctgttaat
ctaatgcccggtttttggacctttatgtggaaggtatccccgtacacgtatttgattcaa
aatttcgtttctttgatgttacatgacaaaacagtcatctgtaccgataaggaactgtct
tactttaacccaccaccgggatcaacttgtggatcttacatgactgactatttcactgaa
gggttcggttatattaagaacccagaggccaccagcaactgtgcttactgcagatacaag
atcggtgatcaatacctatcttacatttctgctaaatatgctgatctatggagaaacttt
ggtttcttatgggtttacatctgctttaacttaatcgcaatggtttcattatattacata
ttccatgttaagcgtttcagcccaaagtctttggtaatgggcgttgttggtaaattcaag
aaagaaaaatga

DBGET integrated database retrieval system