KEGG   Kluyveromyces lactis: KLLA0_D03696gHelp
Entry
KLLA0_D03696g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
kla  Kluyveromyces lactis
Pathway
kla00230  Purine metabolism
kla00240  Pyrimidine metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
Module
kla_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
kla_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
kla_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KLLA0_D03696g
   00240 Pyrimidine metabolism
    KLLA0_D03696g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kla04131]
    KLLA0_D03696g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     KLLA0_D03696g
Membrane trafficking [BR:kla04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    KLLA0_D03696g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-GeneID: 2892803
NCBI-ProteinID: XP_453229
UniProt: Q6CS60
Position
D:317854..318312
Genome map
AA seq 152 aa AA seqDB search
MSNTERTFIAIKPDGVQRGLISKILARFEDRGYKLVGIKLVTPTEALLKEHYADLVSKPF
FPSLLSYMTSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIEVGRNVCHGS
DSVESAEKEIGLWFKKEELIDYKLNQLSWIYE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacactgaaagaactttcattgctatcaagccagatggtgttcaaagaggtttg
atctctaagatcttagctcgttttgaagacagaggttacaaattggttggtattaagttg
gttactccaaccgaagctttgttgaaggagcactacgctgacttggtttccaagccattc
ttcccatctctattgtcttacatgacttctggtccagttttagctactgtctgggaaggt
aaggatgttgttaagcaaggtcgtgctatcttgggtgctaccaacccattgcaatctgct
ccaggtaccatcagaggtgactttgccattgaagttggtagaaatgtctgtcacggttct
gactctgttgaatctgctgaaaaggaaatcggcttgtggttcaagaaggaagaacttatt
gactacaagttgaaccaattgtcttggatctacgaataa

DBGET integrated database retrieval system