KEGG   Kluyveromyces lactis: KLLA0_D03905gHelp
Entry
KLLA0_D03905g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K23856  peroxiredoxin [EC:1.11.1.15]
Organism
kla  Kluyveromyces lactis
Brite
KEGG Orthology (KO) [BR:kla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KLLA0_D03905g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     KLLA0_D03905g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 2892713
NCBI-ProteinID: XP_453239
UniProt: Q6CS50
Position
D:complement(330128..330634)
Genome map
AA seq 168 aa AA seqDB search
MSDDFYSYSCETKDGSEYHMSELRGKVVLIVNVASKCGFRGQYGELQELYKEFHAKGFEI
LAFPCNQFMNQEPGSDEEIGKFCQEHYGVSFKIMKKCKVNGVNALPLYKYLKDQQPRMFG
FTFVRWNFEKFLIDRSGRVHGRYSTLTKPKSMKEDIEQLLKQKSQLQS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgatttctacagttattcttgtgaaactaaagatgggtctgaatatcatatg
agtgaactgcgaggaaaagttgttcttatagttaatgttgcatcgaaatgtggcttccga
ggtcaatatggagagctacaagagttgtacaaagaattccatgcaaaagggtttgaaata
ttagcattcccctgcaatcagttcatgaaccaggaacctggttccgatgaagaaatagga
aaattttgccaggagcactacggtgtcagttttaaaataatgaagaagtgtaaagtgaat
ggtgtcaatgctcttccgctatataagtacttgaaagatcaacaaccgcgaatgtttggg
ttcacgttcgttagatggaattttgagaagtttttgatcgatcgctcagggagagtccat
ggacggtattccacgttgacgaaaccgaaaagtatgaaggaagacatcgaacaattacta
aaacaaaaaagccaactacaatcatga

DBGET integrated database retrieval system