KEGG   Kluyveromyces lactis: KLLA0_D15983gHelp
Entry
KLLA0_D15983g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00380  sulfite reductase (NADPH) flavoprotein alpha-component [EC:1.8.1.2]
Organism
kla  Kluyveromyces lactis
Pathway
kla00920  Sulfur metabolism
kla01100  Metabolic pathways
Module
kla_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KLLA0_D15983g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     KLLA0_D15983g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 NAD_binding_1 PFOR_II
Motif
Other DBs
NCBI-GeneID: 2893064
NCBI-ProteinID: XP_453764
UniProt: Q6CQM5
Position
D:1343315..1346422
Genome map
AA seq 1035 aa AA seqDB search
MSLSYVTNPFGLPTESTQLPTFTTPVNAINSVLFRNLKSIFSYKTFSDPDLLDASIKKLA
ERENGLFFKELDVRSGAGLTTLGFAKGSSDLAGIITPGYALPYFVSSFKQEIDTQSKFVF
SVGSLDYDEASGSIINDYLTPLKAAKDLGFPVITPLQISEVKATTLLTLALAKYGSGLGA
VQLFDGAQYARTVTRVEDKMQDRFIESLNLADDSTFDQILDAFNENSPERLHNFQYYGNE
SAETIFITYGSLETELFASLLNQSGSKVGVLAVRIPLPFDTEKFVSLIPTTVKKIVVIGQ
SLTGQSPSWLRSQVSGALFFHNKRTLTIAEYIYQPNFVWSPKAVKQIVTSFIPSFELEIS
SNSQNFIYWTTDNSNNLDLAARLVQGLSLIDNVDISLRTKFDNIGNAGTFQAQFTSHPSK
SKSVVSNIDSADVIVVEDISILNAYDVASTVKQEGSIIVLVKSSLVDKDLKDKKFYTDEL
KINEAFLTTVAEKKINVTLIDVETIGDREETKGRTLSFVTQAVFWSAATNDDKQSIIRRI
WNSAGPDIELLAAVLSDTISTALETGVKAIPNEVYATFIEDKAKGEEVKEEEIHQLPTFV
TETSFSANQRFTEEVPETEIAKIAEISKKLTFQEAYGVSQQLRPDLPVNNYVVKVKENRR
VTPDDYDRYIFHIEFDISGTGMTYDIGEALGVHAKNNLENVQKFLQYYGLNESDIVQVPN
KDDHHYLESRTVLQAFVENLDIFGKPPKRFYESLIDFCTDDKEKSKLENLVSAAGATELK
RLQDVEYYTYADIFELFPSARPSVEDLVKIIAPLKRREYSIASSQRIHPNEVHLLIVVVD
WIDNKGRKRYGQASKFISDLAIGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAI
VEEKLWQRQQGYEIGEVYLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPEKI
YIQDRIKENLPELKTAMIDNEGSFYLCGPTWPVPDITQALQDIIAADAKEKGINVDLDAA
IEDLKETSRYILEVY
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatcatatgtgaccaatccatttggtcttccaactgagagcactcagttgcca
actttcacaacaccagtgaatgcaattaactctgtgttgttcagaaatctgaagagtatt
ttcagttacaaaacattctcagaccctgatttattggatgcttctatcaaaaagttagct
gaaagagagaacggtttgttctttaaggaattggacgtaagatcaggtgcaggcttgact
actttgggttttgctaagggttcttccgaccttgctggtattatcactccaggttatgct
ttgccttatttcgtcagcagtttcaaacaagaaatcgacacccagtcgaaattcgtcttt
agcgttggttcgttggattatgatgaggcttctggttctataatcaacgattatttgact
cctttgaaagctgcaaaggatttggggttccctgtcattacaccattgcaaatctccgaa
gttaaagctaccacgttattgaccttggcattggctaaatacggttcaggtttgggtgca
gttcagttatttgatggtgcccaatatgcgagaactgtcactagagtggaagataagatg
caagatagatttattgaatcgttgaatttagctgacgattctacttttgatcagatcttg
gatgctttcaatgagaactccccggagagactgcacaacttccaatattacggtaatgag
tctgctgaaactattttcattacttatggttctttggagaccgaactttttgcttctcta
ttgaatcaaagtggctctaaggtcggcgtacttgctgttagaatcccattgccatttgac
actgagaaatttgtttctttgattcctactactgttaagaaaattgtcgtaattggccaa
tctctaactggccagtctccatcctggttgagatctcaggtttcaggtgcgttattcttc
cacaacaagagaactttaaccattgccgagtacatctatcagccaaactttgtttggtcc
ccaaaggctgttaagcaaattgttactagtttcatcccaagtttcgaattggagatatca
agtaattcccaaaacttcatttactggaccactgacaacagtaataatttggatttggct
gctagattagtacaaggtctatcattgatcgataatgttgatatttccttgagaacgaaa
tttgacaacattgggaatgcaggtaccttccaagcacagttcacttcgcatccatcaaag
tcgaaaagtgttgtttctaatatcgactctgccgatgtgattgttgtcgaagacatttcc
attttaaatgcttatgacgtagcttccactgtgaagcaagaaggttccatcattgtattg
gtgaagagctctttggttgataaggatttaaaggataagaagttctacactgatgaattg
aaaattaacgaagcatttttaaccactgttgctgaaaagaagatcaatgttacattgatc
gacgttgaaacaattggtgacagagaggaaactaaaggtcgtactttgtccttcgtcact
caagctgtcttctggagtgctgcaactaacgatgacaaacagagcatcattcgtcgtatc
tggaactcagcaggtcctgatatcgaattacttgctgctgtgttgtctgataccattagt
actgcccttgaaactggcgtgaaggccattccaaatgaagtttacgctacattcattgaa
gataaagctaagggtgaagaagtaaaagaagaagaaatccatcagttaccaacttttgtc
actgaaacctcattctctgcaaaccagagatttaccgaagaagtaccagagactgaaatt
gctaagatcgctgaaatttcaaagaagttgactttccaagaagcttacggagtgtcacaa
caattgaggcctgatttgcccgttaacaattatgtcgttaaagttaaggagaacagacgt
gtcactccagatgactatgatagatacattttccatattgagtttgacatttctgggaca
ggaatgacttacgatattggtgaagcattgggtgttcatgcaaaaaacaacttggagaat
gtgcaaaaattcttgcagtactatggtttgaatgaaagtgacattgttcaggtaccaaat
aaggatgaccatcactacttagagtcaagaaccgttttgcaagccttcgtcgaaaatctt
gatattttcggtaaaccaccaaagcgcttctacgagagtttgatcgatttttgtactgac
gacaaagagaagagtaagctagaaaacttagtttctgctgccggtgctactgaattaaaa
cgcttacaagatgtcgagtactatacttatgccgatatcttcgagttattcccatcagcc
agaccatcggttgaagatcttgtgaaaataattgccccattgaagagaagagaatactct
atcgcatcttctcaaagaatccaccctaacgaagtccatttattgattgtcgttgtggac
tggattgataataagggaagaaagagatatggtcaagcttcaaaattcatttctgattta
gctatcggttctgaacttgttgtatctgtgaaaccaagtgttatgaagttgccaccatct
ccaaagcaaccagttattatgagtggtttaggtactggtttagcacctttcaaggctatc
gtagaagaaaaattgtggcaaagacaacaaggttatgaaatcggtgaagtctatttgtat
ttgggttctagacacaagagagaagaatatttatacggtgaattatgggaagcttataag
gatgctggaattatcactcacatcggtgccgctttctccagagatcaacctgaaaagatt
tacatccaagatcgtatcaaagaaaacttgccagagttgaagactgcaatgattgacaat
gaaggttccttctacttatgtggtccaacgtggcctgttcctgatatcactcaagctcta
caagatattattgctgcagatgcgaaggagaagggcatcaacgttgacttggatgctgcc
attgaagacttaaaggaaacttctagatatatcctagaagtttactga

DBGET integrated database retrieval system