KEGG   Kluyveromyces lactis: KLLA0_F00506gHelp
Entry
KLLA0_F00506g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kla  Kluyveromyces lactis
Pathway
kla00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KLLA0_F00506g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KLLA0_F00506g
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KLLA0_F00506g
    1.1.1.-  
     KLLA0_F00506g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_3 DAO
Motif
Other DBs
NCBI-GeneID: 2895318
NCBI-ProteinID: XP_455102
UniProt: Q6CLT7
Position
F:complement(36518..37675)
Genome map
AA seq 385 aa AA seqDB search
MRALAYFGKQDIRYTKDLEEPVIETDDGIEIEVSWCGICGSDLHEYLDGPIFFPEDGKVH
DVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAEC
AACQRGFYNCCAHLGFMGLGVHSGGFAEKVVVSEKHVVKIPNTLPLDVAALVEPISVSWH
AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRRNQAAKLGVETFDP
SEHKEDAVNILKKLAPGGEGFDFAYDCSGVKPTFDTGVHATTFRGMYVNIAIWGHKPIDF
KPMDVTLQEKFVTGSMCYTIKDFEDVVQALGNGSIAIDKARHLITGRQKIEDGFTKGFDE
LMNHKEKNIKILLTPNNHGELDATN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattagcttatttcggaaaacaagacatcagatacacaaaggatttggaggaa
cctgtcatcgaaacagatgatggaattgaaatcgaagtctcatggtgtggtatctgcggt
agtgatttacacgaatacctagatggtcctattttctttccagaagatggcaaggtccac
gatgttagtggtcttggattgcctcaagctatgggtcatgagatgtccggtatcgtatca
aaagttggaccaaaagtaaccaacatcaaggctggtgatcatgttgttgtagaagccacc
ggtacatgtcttgatcattacacttggcctaacgctgcacatgctaaggatgctgaatgt
gctgcttgtcaaagagggttctacaactgttgtgcccatttgggtttcatgggtctagga
gttcacagtggtggttttgctgaaaaagtcgttgttagtgaaaagcacgttgttaagatt
ccaaacactttaccattggacgttgcagccttagtcgaaccaatctccgtctcatggcat
gctgttagaatctccaagttacagaagggccaatccgccttagttcttggcgcaggtcca
attggattagccaccattttagctttgcaaggtcatggtgcctccaagattgtagtctct
gaaccagctgaaatcagaagaaatcaagctgccaagcttggtgtcgaaaccttcgatcct
tctgaacataaagaagatgccgttaatattttgaagaaattggctccaggtggtgaaggt
ttcgattttgcctacgattgttctggtgttaaaccaacttttgatacaggtgtccatgct
actaccttcagaggtatgtatgttaatattgcaatctggggccacaaacccatcgatttc
aaacctatggacgtcactctgcaagagaaattcgtcaccggttccatgtgttacaccatt
aaagattttgaagatgtggtccaagccttaggcaatggcagcattgctattgataaagct
agacatttgattacgggtagacaaaaaatcgaagatgggttcactaaagggttcgacgaa
ttaatgaaccataaagagaaaaacatcaagatattgttgactcctaataatcatggtgag
ttggatgccaccaactga

DBGET integrated database retrieval system