KEGG   Kluyveromyces lactis: KLLA0_F03014gHelp
Entry
KLLA0_F03014g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
kla  Kluyveromyces lactis
Pathway
kla03013  RNA transport
Brite
KEGG Orthology (KO) [BR:kla00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    KLLA0_F03014g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kla03012]
    KLLA0_F03014g
Translation factors [BR:kla03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    KLLA0_F03014g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI Cytochrom_B562
Motif
Other DBs
NCBI-GeneID: 2895780
NCBI-ProteinID: XP_455216
UniProt: Q6CLH3
Position
F:complement(280155..282614)
Genome map
AA seq 819 aa AA seqDB search
MSRFFLKTYEYDSTSSGEEEDLLSQSEEDLVSSSSEEELSDDSFFNDSDESSDNDEDNDS
DSKPYGPDWFKKPEFRKGGGSGANKFLKSTNYSSDEDSSDEEDGKKVVKSAKEKLLDEMK
SIYQKIDSAEAQQDWESLLNHLETILKLYTKAQQQNYGTPNIFVKSLARFEDAVSATSQD
EIKNKAVARAYNTTKQRVKKLIRENETSVKAYRENPEDFDKEPVLDADIDSRDVSATPFS
LSGKKNLDLASVANNISELDFFKTLNIIIDSRGKKNTDHTEQIKTTEELLKIAKTPYEKI
CTYLNLIPIRFDASVSLSYQPLEQWKASKDNLDGLLEVLEQEIDHYQVTEFAPRNDFIED
EPEANEHGVKEILGSIFSMVERLDDEFSKSLLNIDTRSSEYMERLRDEQSIYNLIIRSQL
YFERVTAEEHRDRLLARVFNRRLEHIYYKSDKLISIMETVAWKQIREGTASLESSFVRLN
ESDSADADYNFKVISELSDFLIKQKSNNVFNYRKGTLYKTYYIALNQEYAPAKKIMLSSD
IAKFISGSDAALQILYNRCVIQLGLAAFKAGLINECHQVLNGLCINPHLREILGQQSLQR
ANANSNVVQGAPVEQLCLPFHQHINLDLIDTVYMTCSLLLDVPHMAAYYSGIKVKRIPVF
QKSIRRILESSEKAIFHGPPETLRDHILYAAKSMQKGDYLQSIEYLRKISVWSLLSKSDD
IINQLSEKVQIETLKTYIFTYKRFYSKISISKLSKLFDLDIEKVLAVAQNIINDYEVKAK
LDENNEYIIFERGEEITKLEEVAIKLVKETKYHSERLRQ
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtttttttttgaagacatatgagtacgattcaacgtcttctggtgaagaagaa
gacttgttatctcaaagtgaagaggatttagtttcatcctccagtgaggaagaattatct
gatgactctttcttcaacgactctgatgagagttccgataatgatgaagacaatgattct
gatagcaaaccctacggccctgactggttcaagaagccagaattcagaaaaggtggtggt
tcaggtgctaacaagttcttgaaatctaccaactattcatctgatgaagactcatccgac
gaagaagatggtaagaaggttgtgaagtcagcaaaagagaagttgttggatgaaatgaaa
tctatttaccaaaaaattgattccgcagaagcccaacaagattgggaatcattattaaac
catttggaaaccattttgaaattatacacaaaagcccaacaacaaaactacggtacacct
aatatctttgtgaagtcattggctagatttgaagatgcggtatctgctacttctcaggat
gaaattaagaataaggcagttgcaagagcttataacaccaccaagcaaagagttaagaag
ttaatcagagaaaacgaaacctccgttaaggcttacagagaaaacccagaggactttgac
aaggaacctgtcttagatgctgatatagactcaagagatgtctctgctactccattctcc
ttgagtggtaagaagaatttagacttggcatccgtggcaaataacatttctgagctagac
tttttcaagacgttgaatattatcatcgattctagaggtaagaaaaacactgaccacaca
gaacaaattaaaaccaccgaagaactattgaagattgccaagactccatatgaaaagatc
tgtacatacttgaacttgattccaatcagattcgatgcatctgtatccttatcataccaa
ccactagaacaatggaaagcatcaaaggataacttggatggtttattggaagtgctggaa
caagagatcgaccactatcaagttactgaatttgccccaagaaatgatttcattgaagat
gaaccagaagctaatgagcatggtgtcaaggaaattttgggttctatcttctctatggtt
gaaagattggacgatgaatttagcaaatcccttttgaacattgacactcgttccagtgaa
tacatggaacgtttgagagatgaacaatctatttacaatttgattatcagatcccaattg
tactttgaacgtgtaactgcagaagaacaccgcgatagacttttggcccgtgtcttcaac
agaagacttgaacatatctactacaagtccgacaagctcatctctattatggaaaccgtt
gcatggaaacaaattcgtgaaggaactgcgtcccttgaatcctctttcgttcgtttgaat
gaatcagattccgcagatgccgattacaacttcaaggtcatctctgaattgtccgatttc
ttaattaaacaaaagagtaacaacgtgttcaactacagaaaaggtaccttgtacaaaaca
tattatattgcattgaaccaagaatacgctccagcaaagaaaataatgctttcttccgat
attgctaaattcatttcaggctctgatgcagcattacaaattttgtacaatagatgtgtt
attcaacttggtttggctgcatttaaggctggtttaataaatgaatgtcaccaagttttg
aacggtctttgtattaatccacatctaagagaaattttgggtcaacaaagtttacaaaga
gctaatgcgaacagcaatgtcgtgcagggtgcccctgttgaacaattatgtcttcctttc
catcaacacatcaacttggatctaattgacaccgtctacatgacatgttctttattactt
gatgtgcctcacatggcagcttattacagcggtattaaggtcaagagaatcccagttttc
caaaaatctatccgccgtattctagagagttcagagaaagctattttccatggtcctcca
gaaactctaagagatcacattctttatgctgcaaagtcaatgcaaaagggtgattactta
caatcgatcgaatatttgaggaaaatttctgtgtggtctttgttgagtaaatctgatgat
atcatcaaccaactaagtgaaaaggttcaaattgaaactttgaaaacttacattttcact
tacaagagattctactctaaaatatccatttctaaattatcgaaattgtttgatcttgat
atcgaaaaggttttggctgtagcacaaaacatcatcaatgattacgaagttaaagccaaa
ttggatgaaaataacgaatacattatcttcgaaagaggcgaagaaatcacaaagttagaa
gaagttgccatcaagttagttaaagaaaccaagtaccactctgaacgtttacgccagtaa

DBGET integrated database retrieval system