KEGG   Kluyveromyces lactis: KLLA0_F10813gHelp
Entry
KLLA0_F10813g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20498  D-serine ammonia-lyase [EC:4.3.1.18]
Organism
kla  Kluyveromyces lactis
Pathway
kla00260  Glycine, serine and threonine metabolism
kla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLLA0_F10813g
Enzymes [BR:kla01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     KLLA0_F10813g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: D-ser_dehydrat Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 2895076
NCBI-ProteinID: XP_455572
UniProt: Q6CKG7
Position
F:complement(993942..995270)
Genome map
AA seq 442 aa AA seqDB search
MATQLSPSERYPLDPAGVQESIRNAYKGRHYKELPTPALIMKEPVIDSNISTLLQSIDSI
NSLLERPVKYRAHIKTHKTIEGTLKQLGHNLPEYDGPKYGSIVVSTLREAYLVLDYHEKK
KTKIVTDMAYGLPACVPDIIPQLYEISKKVDHFRIFVDNIQHIDFLEKFAKELGDPDFKW
SVFVKIDCGTHRAGVFLEEDLIALLERLLKATDSIELFGFYAHAGHSYSKSSAEANESVL
REEIDHVNNACNTLLAIDEEYPVSKLILSVGASPTARSFQYATNTSELSQYINNLHGTLE
LHAGNLMISDLQQVSTGAITEHNISSFVLGTVISQYPKRGNSIGEMLTNTGVLSMTKEVS
HKFPGYGLLPEHPEYGQWFLQRLSQEHGILQPLDDDCKMIPHGTKVEILMQHVCITMACF
GHYFVVNDEGIITDVWIPCRGW
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctacgcaattgagtccatctgagagatatccactcgatcctgcaggtgtacaggaa
tccatccgaaatgcctacaaagggaggcattataaggagttaccaactccagcgttaatt
atgaaagaacctgtaattgattccaatataagcactttacttcaatccattgatagtatc
aacagccttttggagagacctgttaagtatcgtgctcatatcaagactcataagacaatc
gagggcacattgaaacaattgggtcataaccttcctgaatatgatggccccaaatatggt
tccatagtggtgagtacccttagagaggcgtacttggtattggattaccatgaaaaaaag
aagactaagatcgttacagacatggcttatggattacctgcgtgtgttcctgacattatt
cctcagttatacgaaatctccaagaaagttgatcactttagaatctttgttgataacatt
caacatattgacttcctggaaaagttcgctaaggaattgggtgatcccgatttcaagtgg
tctgttttcgttaagatagattgtggaacccacagagctggggttttcctagaagaggac
ttaattgctcttttagaaagattactgaaggcaactgattccattgaattatttggattt
tacgctcatgcaggacattcatattctaaatcgtctgcagaggctaatgaatctgtgttg
agagaagaaattgaccatgtcaataatgcttgcaatacacttcttgcaattgacgaggaa
tatccagtttctaagttgatattgagtgttggtgcttcacccaccgcaaggtctttccaa
tatgctacgaacacttctgaactctcccaatacattaataacttacatgggactctagaa
ttgcatgcaggtaacttaatgatttctgacttgcaacaggtttctacaggtgcgattaca
gagcataatatttcctcttttgttttaggtactgtcatatcgcaatacccaaagagaggc
aattcaattggggaaatgttaacgaacactggtgttttatcaatgacaaaagaagtttcc
cacaaattcccgggctatggtttgttgcctgaacacccagagtatggacagtggttttta
caaagactctcccaagaacatggtattttgcagccgctagatgacgattgcaaaatgata
cctcacggtacaaaagttgaaatactaatgcaacacgtatgtatcaccatggcatgtttc
ggtcactattttgtggtgaatgatgaaggcataattactgatgtctggattccatgtaga
ggctggtaa

DBGET integrated database retrieval system