KEGG   Kluyveromyces lactis: KLLA0_F14971gHelp
Entry
KLLA0_F14971g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kla  Kluyveromyces lactis
Pathway
kla00450  Selenocompound metabolism
kla00970  Aminoacyl-tRNA biosynthesis
kla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KLLA0_F14971g
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KLLA0_F14971g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kla01007]
    KLLA0_F14971g
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kla03016]
    KLLA0_F14971g
Enzymes [BR:kla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KLLA0_F14971g
Amino acid related enzymes [BR:kla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KLLA0_F14971g
Transfer RNA biogenesis [BR:kla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KLLA0_F14971g
 Prokaryotic type
   Other AARSs
    KLLA0_F14971g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 2894789
NCBI-ProteinID: XP_455753
UniProt: Q6CJY6
Position
F:complement(1386169..1387875)
Genome map
AA seq 568 aa AA seqDB search
MTSKAVRAVSKFHITTPIFYPNAKPHLGHLYSSLLCDVQNRWKKLAGQDTCFTTGVDEHG
LKIQLAAQQKGYSNPKAFVDELCEHFVHLDKDANIKFTRFIRTTDPDHVNNVKKLWNLCY
NNGYIYKGEHKGWYSVSDETFYPDTKILKLTIDGPPIPYDGSFDPDAKYINSESRNEVTY
QSELNYFFKLSAFQEPLIKLLRENPTFIYPPLRHSQILRELESNELRDISVSRPATRLQW
GIPVPEDESQKVYVWFDALCNYLTSIGGIDAIRNDVDSTQVLHNNRSFIEKPKEWWENTE
HVIGKDIIKFHTVYWPAFLLAAKLPLPNRVVVHGHWLSGGVKMSKSLGNVVDPIQIISYY
GADTTRWYLLENSNIESDGNFIEKNLWETRELLCSKLGNLINRCGGKKFSLASGVELFSG
KPIEELSSVFPKESQAEFTALLKSLDNCTESVNNCFQQYDITGAQKILWNIINEANSFIQ
STEPWSKKGLEKDLIVYSAMEAARISLIFSQPIIPNIAERLLNRLDVSSDRRTLSYTSYG
SDDSYGMTTNQRHKEVPIQRVPFRLHNE
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaaagcggtacgagcggtatcgaaatttcacattaccactccaatattttat
cccaatgcaaaacctcatttagggcacctttacagcagtctactgtgtgatgtgcaaaat
agatggaagaaacttgccggccaggatacttgcttcacgaccggtgtagacgagcatggt
ttgaaaattcaactggctgctcagcagaaaggttacagtaatcccaaagcttttgttgat
gagttgtgcgagcatttcgttcatttagacaaggacgctaatattaagtttaccagattc
ataagaaccactgatccagatcatgtaaataatgtgaaaaagctctggaacctatgctac
aataacgggtacatttataagggggagcataaaggctggtattctgtttctgatgagaca
ttttatccagatacgaaaatcttaaagttgactatcgacggtccaccaataccatatgac
ggtagcttcgatcctgatgctaaatacatcaactccgaatctaggaacgaggttacatat
caatctgaactaaactacttcttcaagctatcagcgtttcaagaaccattgatcaaatta
ttaagagagaatccaacattcatttatcctcctttaagacattcgcaaatcctgagagaa
cttgaatccaatgaactgcgggatatatctgtatcgcgtcctgcgactcggctacaatgg
ggtatacccgtaccagaggatgaatctcaaaaagtgtatgtgtggtttgatgcgctatgt
aattaccttacctctattggtggtatcgatgcaattagaaatgacgtagactcgacacaa
gttttgcacaataacagaagttttatcgaaaagccaaaagagtggtgggaaaacacggaa
cacgttattggcaaggatattatcaagttccacacagtatattggcctgcgttcttgttg
gcggcgaaattacctttaccaaacagagttgttgttcacggccattggctaagtggagga
gtgaagatgagtaaaagtcttggaaacgtggtggatcctattcagattatctcatattat
ggagcagatacaacaagatggtatctacttgagaactctaatatcgaaagtgatggaaac
tttattgaaaaaaacctgtgggaaaccagggagcttctttgctcgaagttgggtaacttg
ataaaccgttgcggcggtaagaaattctctctagcctcaggagttgaactattttctgga
aaacccatcgaggaactaagttcggtcttccctaaggaatctcaggctgaattcaccgct
ttattaaaaagtctagacaactgcactgagagtgttaacaattgtttccagcaatacgat
ataactggcgcccaaaaaatcttatggaacattattaacgaagcaaacagttttattcaa
tcaaccgaaccttggtctaaaaagggccttgaaaaggatttgatcgtttacagcgcaatg
gaggctgccaggattagcctgatcttttcacaaccaataattcccaacattgccgaaagg
ctactaaacagattagatgttagctctgatagaaggactttgagttatactagctatggc
tctgatgactcttatggcatgaccacgaatcagagacacaaagaggttccgatacaaaga
gtgccgttcagacttcataatgaataa

DBGET integrated database retrieval system