KEGG   Kluyveromyces lactis: KLLA0_F27181gHelp
Entry
KLLA0_F27181g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11273  chromosome transmission fidelity protein 1 [EC:3.6.4.13]
Organism
kla  Kluyveromyces lactis
Brite
KEGG Orthology (KO) [BR:kla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kla03036]
    KLLA0_F27181g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     KLLA0_F27181g
Chromosome and associated proteins [BR:kla03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    KLLA0_F27181g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C_2 DEAD_2 ResIII DEAD PhoH DUF4778
Motif
Other DBs
NCBI-GeneID: 2894899
NCBI-ProteinID: XP_456289
UniProt: Q6CIF0
Position
F:complement(2510636..2513059)
Genome map
AA seq 807 aa AA seqDB search
MGKNFHHPYQPYDIQTQLMEHIYELLNSGKKVGIFESPTGTGKTLSLICSTVTWLREHKL
EKLNSKVDNDNLSDSTFSSSDDEPEWVNQFYNDKIMKEKSKSLQEYENYLEGLSMSNIKP
VLRQLDIGDRKRKKTVPRHIEIEIEDDETNFLPEPYEQDSVSNQNDYEKGQINDEIQKLL
AKIDKGYDVKTENNMELKSPLKIYFSSRTHSQLTQFASQLTLPSFPPSSPTLEKERIKFL
PLASRKQLCIHAKVSKLKSDLINDACVETVKRQECQFYTNSRDLISSKQFRDYTFSEISD
IEDLVQLGHSLHVCPYYSSRTALEGAEIVTLPYQHILSFEIRESLGINLKDSIVIIDEAH
NLMDTITSIYSCEISLSDIKICKKLMKIYLNKFKRKLNGKNRVNIMKLMKLLDILQAFIE
SHFEKGKEISPQSMFRDSNADLLNIHELVTYMRGSKIAYKIDSYADSKLKSDESNTNSVK
QPILFKISKFVLSLSNPSFEGSFFFEEGMIIKYMLLEPNQIFKTIVNDSKCVILAGGTMQ
PTSEFIENLLPFVPSKDIVQFSCNHIIPESNLDTFIVSEGFNFNYESRNNESVMCKLYDF
LLELGCRVPHGIVVFFPSYGYLEHVIKFWQLEEIFEKLSMNKRIFYETPGGSDILPQYSS
TILDKKKGAFLFSVVGGKLSEGINFQDNLARAVVMVGLPYPNLYSSELLVKKRHIEQKVI
SAGGSLKDAKSATIEFYENICMKAVNQSIGRAIRHANDYACIYLVDNRYLNNKVQHKLSE
WVRKRVKSELKTSEIFAQTSVFFASNR
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaatttccatcatccttatcagccttatgatattcagacacagttaatggaa
catatatatgagctactgaattctggtaagaaagttggtatctttgaaagtcctacaggc
accggtaaaactttatctctgatctgtagcactgtaacttggttgcgtgagcataaatta
gaaaaattgaatagcaaagtggacaatgacaatttgtcggattctactttctcatcttct
gacgacgaaccagaatgggtgaatcagttctataacgataaaattatgaaggagaaatcc
aaaagtttgcaagaatacgaaaactatttagagggactttccatgtccaacataaaacct
gtactaaggcaactcgacattggcgacagaaagagaaaaaagacagttcctcgacatata
gaaattgaaattgaggatgatgaaactaatttccttccagagccctatgaacaagattcg
gtttcaaatcaaaacgattatgagaagggccagataaatgacgaaattcagaagctacta
gctaaaattgacaaaggatatgatgtaaaaacagaaaataacatggaattgaaatccccc
ttgaaaatttacttctcatcaagaactcattcacagttaactcaatttgcatctcaattg
actttgccatcttttccgccgtcatcacctacactagaaaaagaacgcatcaaattttta
ccacttgcctcaagaaaacaattgtgtatccatgcgaaggtatcaaagctaaaaagtgac
ttgataaatgacgcctgtgtcgaaacagtgaaacggcaagaatgccagttttataccaat
tctagggacctgatttcttcaaagcaattccgtgattatacattctcagaaattagtgac
atcgaagacctggttcagttgggacattccctccatgtgtgcccgtactactcatcaagg
acagcattggagggtgccgaaatagtgaccctgccttaccagcatatattgtcctttgaa
attcgagagtctcttgggatcaatcttaaagacagcattgtgataatagatgaggcccac
aacttgatggatactataacatctatatatagctgcgaaatatcgctgtctgatattaaa
atctgcaagaagttgatgaaaatttacctcaacaagtttaaaaggaaactcaacggaaaa
aaccgtgtcaacataatgaagcttatgaaattattggatatactgcaagcatttatagaa
tctcactttgagaaagggaaagaaatttcaccacagtcaatgtttcgagatagtaatgcg
gatttattaaacatccatgagctggtaacttatatgagaggctccaaaattgcatataaa
attgacagttacgcagattcaaagctcaaatctgatgaaagtaatacaaactctgtgaag
caaccaattcttttcaaaatctcaaaatttgttttgtccctatcaaatccctcttttgaa
ggttcgttctttttcgaagaaggaatgataatcaaatacatgctgctggaacccaatcag
attttcaagacaatagtaaacgacagtaaatgcgttattcttgctggtggaacgatgcaa
cctacttccgaattcatagagaatcttctgccttttgttccttcaaaagatatcgtacag
ttttcttgcaatcatattataccagaatcaaaccttgatacgtttatcgtatctgaggga
ttcaatttcaactatgaaagcagaaataacgaatcagtaatgtgcaagctttatgacttc
cttctggaacttggctgcagagtacctcatggtattgtagtattttttcccagttatggg
tatcttgagcacgttatcaaattttggcaattggaggaaattttcgaaaaactgtctatg
aataagagaatattctatgagactcctggtggaagtgatatactgccacaatattcctcg
acgattctcgataaaaaaaaaggtgcctttctattctcagtggtgggaggtaaactctcc
gagggcataaatttccaagataacctagcgagagcagttgttatggtaggccttccatat
ccaaatctctatagtagtgaactacttgtcaaaaaacggcatatcgagcaaaaggtgata
tctgccggaggttctttaaaagacgctaagtcagcaactatcgaattctatgagaatata
tgtatgaaggctgttaatcagagtataggaagagcaattcgacacgcaaatgattacgca
tgcatatatctcgtagacaatagatacttaaacaataaagttcaacataaactgtctgaa
tgggtcagaaagagggttaagtcggaacttaaaacttcagagatatttgcacagacttct
gtgttttttgcatctaatcgatga

DBGET integrated database retrieval system