KEGG   Enterobacter lignolyticus G5: AO703_00340Help
Entry
AO703_00340       CDS       T04198                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00520  Amino sugar and nucleotide sugar metabolism
kle01100  Metabolic pathways
kle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AO703_00340
Enzymes [BR:kle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AO703_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALR74834
Position
complement(75531..76712)
Genome map
AA seq 393 aa AA seqDB search
MKIQSKRVWSGGGFYPAQITIEDGKICDVTPGTGSDADDDYGALRLIPGLIDTHTHGAWN
YDANENDPDGLRRWAARLPAEGVTAFCPTTVTDEDATLLAALNNIARVMDEGCAGAEMLG
IHLEGPFLSQKYRGAQPEKQIRPASLRDFQVFEQAARGRIVAITLAPEEDAGFALTRYCA
QKGIVVNMGHSDATFEQALAAVANGAKNVTHVYNGMAKYVNREPGLLGAALRLDGLYGEV
IADGIFVSLVSASHLYRVKNDNDVIMISDSMKAKGCPPGRYLFGGEPMILGEDGATRREN
GVLVGSTLQLNRGLYNMVEGAMVPFGAALKSCTLNPARLLGLDHRKGRLARGFDADIVVL
EDDYQVNTTFCRGERVFTRTSSPCAPAPRAFSG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccagagtaaacgcgtgtggtcaggcggcggattttatccggcgcaaatcacc
attgaagacgggaaaatctgcgacgtcacgcccggtaccggctcagatgcggatgatgac
tacggcgcgctgcgcctcattcccgggctgatagatacgcatacccacggcgcctggaat
tacgacgccaacgaaaacgacccggacggcctgcggcgctgggcggccaggctgcccgct
gagggcgtaaccgcattctgcccgaccacggtcaccgatgaagacgccacgctgctggcg
gcgcttaacaacatcgcccgggtaatggacgagggctgtgcgggcgcggaaatgctcggc
atccatcttgaagggccgtttttgagccagaaataccggggggcgcagccggaaaaacag
atccgccccgccagcctgcgcgacttccaggtgttcgaacaggcggcccgggggcgcatt
gtcgccatcacgctggcccctgaagaagacgccggttttgccctcacccgctactgcgcg
caaaagggcattgtggtcaatatgggccactcggacgccacctttgagcaggcgctggcc
gccgttgccaacggcgcgaaaaacgtcacccacgtgtacaacggcatggcgaaatacgtt
aaccgcgagcccggcctgctgggggcagcgctgcggctggacggcctttacggtgaagtt
atcgccgacgggatttttgtcagcctggtgtcggcatcgcacctgtaccgggtgaagaat
gacaatgacgtcatcatgatcagcgattcgatgaaagcgaaaggctgcccgccggggcgc
tacctgttcggcggcgaaccgatgatcctcggggaagacggcgccacgcggcgcgagaac
ggcgtgctggtcggcagcacgctgcagctgaaccgcgggctgtacaatatggtggaaggg
gcgatggtgccgttcggcgcggcgctaaaatcctgcaccctcaacccggcgcgcctgctg
gggctggaccaccgcaaaggccgtctggcgcggggctttgacgccgacatcgtggtactg
gaggacgattaccaggtcaataccacgttttgccggggggagcgcgtctttacgcggacg
tcgtcaccttgcgcacctgcgcctcgcgctttttcaggctga

DBGET integrated database retrieval system