KEGG   Enterobacter lignolyticus G5: AO703_01960Help
Entry
AO703_01960       CDS       T04198                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00564  Glycerophospholipid metabolism
kle01100  Metabolic pathways
kle01110  Biosynthesis of secondary metabolites
Module
kle_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AO703_01960 (psd)
Enzymes [BR:kle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AO703_01960 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ALR75119
Position
complement(432572..433501)
Genome map
AA seq 309 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLAIDLFVKCYKVDMKEAQKPDTASY
RTFNDFFVRPLREDVRPVNTDPNVLVMPADGTLNQLGRIEDDKILQAKGHNYSLEALLAG
NYLMADLFRNGTFATTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNILTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGVIKRWTWPAGESEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVQLVDSAKDMSVTRIGQPLAIASEAAATPDAEPAPQ
AEDADKDEG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaattcattcaaactttcgctgcaatacattctgccgaagctgtggctgacgcgt
ctcgctggctggggcgcgagcaagcgggcgggctggctgacaaagctggcgatcgacctg
ttcgtcaaatgctataaggtcgatatgaaagaggcgcagaagccggataccgccagctat
cgcacctttaacgactttttcgtacgcccgctgcgtgaagacgttcgtccggtgaatacc
gacccgaacgtgctggtcatgccggccgacggcaccctgaaccagctgggccgcatcgaa
gacgacaagattctgcaggccaaaggacataactactccctggaagcgctgctggcaggc
aactatctgatggcggacctgttccgcaacggtactttcgccaccacctacctgtcgccg
cgcgactatcaccgcgttcacatgccgtgcaacggcatcctgcgtgaaatgatctacgtg
ccgggcgatctgttctccgttaacatcctgacggcgcagaacgttcccaatctgtttgcg
cgtaacgagcgcgtcatttgcctgttcgatactgagtttggcccgatggcgcagattctg
gtcggcgcgactattgttggcagcatcgaaaccgtctgggcaggcaccatcacgccgccg
cgcgaaggcgttatcaaacgctggacgtggcctgctggcgaaagcgaaggctctgtagcg
ctgctgaaaggccaggaaatgggccgctttaagctgggctcaacggttatcaacctgttt
gcgccgggtaaagtacagctggtggattccgcgaaggatatgtcggtgacccgcatcggg
cagccgctggctatcgccagcgaagccgcagcaacaccggacgctgagcctgcaccacag
gcggaagacgcagacaaagacgaaggctaa

DBGET integrated database retrieval system