KEGG   Enterobacter lignolyticus G5: AO703_08280
Entry
AO703_08280       CDS       T04198                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00230  Purine metabolism
kle01100  Metabolic pathways
kle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AO703_08280
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ALR76294
Position
complement(1800878..1801369)
AA seq 163 aa
MNHASWVTVTCTINGAPYQFTLSPATPLSDLLRTQGLLSVKQGCCVGECGACTVLIDGTA
IDSCLYLAAWIDGKEIRTLEGESVGGELSAVQAAYAKSGAVQCGFCTPGLVMATKALLAK
PHVKPFTVQEIRRGLAGNLCRCTGYQLVVDTVLTLEKEQERND
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaaccacgcatcctgggttaccgtgacctgcaccatcaacggcgcgccttaccagttc
acgctctctcccgcaacgccgctttccgacctgctgcgtacgcaggggctgctgagcgtg
aagcagggctgctgcgttggcgaatgcggcgcctgtacggtgcttattgacggtacggct
atcgacagctgtctctacctcgcggcctggattgacgggaaggagattcgcaccctggaa
ggagagtcggtgggcggtgagctgtcggccgtgcaggcggcctatgcgaaatccggcgcg
gtgcagtgcggcttctgcacgccggggctggtcatggcgacaaaggcgctactggcgaaa
ccgcacgtgaagccgtttacggtgcaggagatccgacgcgggctggcggggaatttatgc
cgctgcaccggttatcagctggtggtcgacacggttctcacgctggaaaaggagcaggag
cgcaacgactga

DBGET integrated database retrieval system