KEGG   Enterobacter lignolyticus G5: AO703_08290
Entry
AO703_08290       CDS       T04198                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00230  Purine metabolism
kle01100  Metabolic pathways
kle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AO703_08290
Enzymes [BR:kle01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AO703_08290
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ALR76296
Position
complement(1802252..1804549)
AA seq 765 aa
MDELEATATGEPCMRVDAMAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAKQIDSAAA
RALPGVLAIFTWEDVPETPFATAGHAWTLEPEKRDVADRRLLTRHVRHHGDAVAVVVARD
ELTAEKAAHLVNVEWEALPVITTPGAALADGAVAIHEGGNLLKATEILADDPHGAIAAAD
RQFSNHFQTPVIQHCHMEGVTCFAWMEEDKRITIVSSTQIPHIVRRIVGQALGISWSSIR
VIKPHVGGGFGNKQDVLEEPMAAFLTAKLGGIPVKVALSREECFLASRTRHAFTIDARLG
INRDGTLKGYCLDVLSNTGAYASHGHSIASAGGNKIAYLYPRSAFGYRATTCYTNLPSAG
AMRGYGAPQVVFALEALLDDAAAALDLDPVDIRLRNVAREGDKNPVNRKTIFSAGLPECL
RKGRELFDWDKRRADYREQQGNLRHGVGVACFSYSSNTWPVGVEIAGARLLLNQDGCIHV
QSGATEIGQGADTVFTQMVAETVGMPFGMVHVISTQDTDITPFDPGAFASRQSYVAAPAL
REAARQLRDKILQHAAEMLHQSSLNLTIRHGMIEMTERPGVALASVADVAMDAFYHPERG
GQLSAEASVKTTTNPPAFGCTFVDLTVDVALCKITINRILNVHDSGRILNPLLAEGQVHG
GMGMGIGWSIFEEMIIDETTGLVRNPNLLDYKMPTMMDLPPLESAFVDSCEPQSAYGHKS
LGEPPIIPVAAAIRNAVRMATGVGINTLPLTPKRLFIEFRQAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatgagctggaagccaccgccaccggtgaaccctgtatgcgcgtagacgcgatggcc
aaggtcaccgggcgcgcgcgttatacagacgattacgtcatggcaggcatgtgttacgcg
aaatacgttcgcagcccgatagcccacggatacgcaaaacagatagacagcgccgccgcc
cgggcgcttcccggcgtgctggcgatttttacctgggaggacgtcccggaaacgccgttt
gccaccgccgggcacgcctggacgctggagccggaaaaacgcgacgtcgccgaccgccgc
ctgttgacccgccacgtccgccaccatggggatgcggtagctgtcgtggtggcgcgcgat
gagctgaccgccgaaaaagcggcgcacctggtgaacgtggagtgggaggcgctgccggtc
attacgacgcccggcgccgcgctggcggacggcgccgtcgccatccacgaaggcggcaac
ctgctgaaggccaccgaaattctcgccgacgatccgcatggcgcgatcgccgccgccgat
cggcagttcagcaaccactttcagacgccggtcatccagcattgccatatggaaggcgtg
acctgctttgcgtggatggaagaagacaagcgcatcaccattgtctcgagcacgcaaatt
ccgcatatcgtacgccgcatcgtcggccaggcgctgggaatctcctggtcctccattcgg
gtgatcaaaccccacgtcggcggcggtttcggcaacaagcaggacgtactggaagagccg
atggcggcttttctcacggccaaactcggcggcattccggtcaaggtggcgctgagccgc
gaagagtgcttcctcgccagccgcacccgccacgccttcaccatcgacgcccggcttggc
atcaaccgcgacggtacgctgaagggctactgccttgacgtgctgtcgaataccggcgcg
tacgcctcgcacggccactcgatagcctccgcagggggtaacaagattgcctacctttac
ccgcgcagcgccttcggctaccgcgccaccacctgttacaccaacctgccctccgctggc
gccatgcgcggctacggcgcgccgcaggtggtgttcgcgcttgaggcgctgctggatgac
gccgccgccgcgcttgatcttgacccggtcgatatccgcctgcgcaacgtcgcccgggaa
ggcgataaaaacccggttaatcgcaaaaccatcttcagcgccggtttaccggagtgcctg
cgcaagggccgcgagctgttcgactgggataaacgccgcgccgactaccgcgaacagcag
ggcaacctccgccacggcgtcggcgttgcctgcttcagctacagctcaaatacctggccg
gtcggggtggaaattgcgggcgcccgcctgctgctcaaccaggacggctgtatccacgta
cagagcggcgcgaccgaaatcggccagggtgccgacacggtcttcacccagatggtcgcc
gaaaccgttggtatgccgttcggtatggtgcacgtcatctccacccaggataccgacatt
acgccgttcgacccgggcgcgtttgcctcccgccagagctatgtcgcggcgcccgcgctg
cgcgaggcggcccgtcagctgcgcgacaagatactccagcacgccgccgaaatgctgcac
cagtcatcgctgaacctgacgattcgccacggcatgatcgagatgaccgaacgccctggg
gtcgcgctggcgtcggttgccgacgtggcgatggatgcgttctaccatccggagcgcggc
ggccagctgtcggcggaagcgtcggtgaaaaccaccaccaacccgcccgccttcggctgc
acctttgtcgacctcaccgtcgacgtggcgctgtgcaaaatcaccatcaaccgcattctg
aacgtccatgactccgggcggatcctcaacccgctgctggcggaaggccaggtccacggc
ggaatgggcatgggcatcggctggtcgattttcgaggagatgatcatcgacgagaccaca
ggactggtgcgtaaccccaacctgctggactacaaaatgccgaccatgatggatctgccg
cctctggaaagcgcctttgtcgacagctgcgaaccgcagtctgcctatggacataaatcg
ctcggcgagccgccgattattccggtggcggccgctatccgcaatgcggtccgcatggcg
accggggttggcatcaataccctgccgctgacgccgaaacgcctgtttatcgagttccgc
caggcgggattgatttaa

DBGET integrated database retrieval system