KEGG   Enterobacter lignolyticus G5: AO703_17170Help
Entry
AO703_17170       CDS       T04198                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00071  Fatty acid degradation
kle00072  Synthesis and degradation of ketone bodies
kle00280  Valine, leucine and isoleucine degradation
kle00310  Lysine degradation
kle00362  Benzoate degradation
kle00380  Tryptophan metabolism
kle00620  Pyruvate metabolism
kle00630  Glyoxylate and dicarboxylate metabolism
kle00640  Propanoate metabolism
kle00650  Butanoate metabolism
kle00900  Terpenoid backbone biosynthesis
kle01100  Metabolic pathways
kle01110  Biosynthesis of secondary metabolites
kle01120  Microbial metabolism in diverse environments
kle01130  Biosynthesis of antibiotics
kle01200  Carbon metabolism
kle01212  Fatty acid metabolism
kle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AO703_17170
   00630 Glyoxylate and dicarboxylate metabolism
    AO703_17170
   00640 Propanoate metabolism
    AO703_17170
   00650 Butanoate metabolism
    AO703_17170
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AO703_17170
   00072 Synthesis and degradation of ketone bodies
    AO703_17170
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AO703_17170
   00310 Lysine degradation
    AO703_17170
   00380 Tryptophan metabolism
    AO703_17170
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AO703_17170
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AO703_17170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AO703_17170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kle04147]
    AO703_17170
Enzymes [BR:kle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AO703_17170
Exosome [BR:kle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AO703_17170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALR77945
Position
complement(3715868..3717049)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAVRTPIGCFQGALSGFTAVELGCLVVRALVERTGIDPHSVDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGARLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRERQDAWAL
SSQQKARRAIDSGRFRDEIVPVVNVQKNGVTRIVDTDEQPRTDASAEGLASLSPAFESAG
SVTAGNASSINDGAAAVMMMSESKALALNLPILARIRAFASVGVDPALMGIAPVYATRRC
LERVGWHLDEVDLIEANEAFAAQAISVGKVLEWDERRVNVNGGAIALGHPIGASGCRILV
SLVHEMIKRDARKGLATLCIGGGQGVALAVERE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtcgttatcgtaggtgcggttcgcactcccatcggttgcttccagggcgca
ttgtccggctttaccgctgtggaattaggctgtctggttgtgcgggcgctggtcgagaga
acagggattgatccccacagcgtagacgaagtgatcctcggccaggtgttaacggcgggc
gccgggcaaaacccggcccgtcagtcggccatcaagggcggtttgcctaacaccgtatcg
gctatcaccatcaacgacgtctgcggctctggcctgaaggcgctgcatctggcgacccag
gctatccagtgcggggaggcggatgtggtgatcgccggcggtcaggaaaacatgagccgc
gcgccgcacgtgctgaccgacagccgcaccggagcgcgtcttggcaacagccagcttatc
gacagcctcgtccacgacgggctgtgggatgccttcaacgactatcacatgggcgtcact
gcggaaaacctggcccgggagtacggcatcagccgcgagcgccaggatgcctgggcgctc
agctcgcagcagaaagcgcgcagagcgattgactccgggcgctttcgcgatgaaatcgtt
ccggtcgtcaacgtgcaaaaaaacggcgtcacccggattgtcgataccgacgagcagccg
cgtaccgacgccagcgcggaagggctggcgagcctgtcgcctgcgtttgagagcgccggt
tccgtgaccgcggggaatgcctcttccattaacgacggcgcggcggcggtgatgatgatg
agcgaatcaaaagcgctggcgctgaacctgccgatcctggcgcgcattcgcgcctttgcc
agcgttggcgtcgatccggcgctgatgggcattgcgccagtctacgcaacccgccgctgc
ctggaacgggtgggctggcatcttgacgaggtagatctgattgaagccaacgaggctttc
gccgcgcaggctatctccgttggcaaagtgctggagtgggacgaacggcgggtcaacgtg
aacggcggcgccattgcgctcggacaccccatcggcgcttccggctgccgcatcctggtt
tcgctggtgcatgagatgataaagcgcgatgcccgcaaggggctggcgacgctgtgcatc
ggcggcgggcagggcgttgcgctcgccgtggagcgtgaatag

DBGET integrated database retrieval system