KEGG   Enterobacter lignolyticus G5: AO703_19755Help
Entry
AO703_19755       CDS       T04198                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00010  Glycolysis / Gluconeogenesis
kle00020  Citrate cycle (TCA cycle)
kle00620  Pyruvate metabolism
kle01100  Metabolic pathways
kle01110  Biosynthesis of secondary metabolites
kle01120  Microbial metabolism in diverse environments
kle01130  Biosynthesis of antibiotics
kle01200  Carbon metabolism
Module
kle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO703_19755
   00020 Citrate cycle (TCA cycle)
    AO703_19755
   00620 Pyruvate metabolism
    AO703_19755
Enzymes [BR:kle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     AO703_19755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 Pox_C4_C10
Motif
Other DBs
NCBI-ProteinID: ALR78427
Position
4238612..4240231
Genome map
AA seq 539 aa AA seqDB search
MRVKGITPQDLKAYGINDVQDIVYNPDYDTLYQEELNPNLEGYERGVLTNLGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTVWWSDKGKGKNDNKPLSPETWQHLKQLVTHQLSGKRLFII
DAYCGANADTRLCVRFITEVAWQAHFVKNMFIRPTDEELATFKPDFVVMNGAKCVNPQWQ
AQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIY
HAIRRDALLENVTVLADGTIDFDDASKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILDGSLDNAETFTLPMFDLA
IPTALPGVDTHILDPRNTYGSPEQWREKAETLAKLFIENFEKYTDTPAGEALVSAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaaaggtataaccccgcaggatctcaaggcttatggaatcaacgacgttcag
gatatcgtctacaaccccgactacgatacgttgtatcaggaagagctcaatcccaacctg
gaaggttacgagcgcggtgtgttaacgaatcttggtgctatcgccgtcgacaccggtatt
tttaccggccgttcgccgaaagataagtatattgtccgcgacgacacgacacgggatacc
gtgtggtggtcagataaaggtaaagggaagaacgataacaaaccgctctccccggagacc
tggcagcacctgaagcagctggtgactcatcagctttccggcaagcggctgtttatcatt
gacgcttattgcggcgcaaacgccgatacgcgtctgtgcgtccgttttatcaccgaggtg
gcctggcaggcgcacttcgtgaaaaacatgttcattcgcccaaccgacgaagagctggca
acattcaagccggatttcgtggtcatgaacggtgcgaagtgcgtgaacccgcagtggcag
gcgcaggggctgaactccgaaaacttcgtggccttcaacctgaccgagcgtattcagctt
atcggcggcacctggtacggcggcgaaatgaaaaaagggatgttctcgatcatgaactac
ctgctgccgctgaaaggcatcgcgtcgatgcactgctccgctaacgtgggcgagaaaggc
gacgtggcggtgttcttcgggctttccggcaccggtaaaaccaccctgtccaccgacccg
aaacgtcgcctgatcggcgatgacgaacacggctgggacgatgacggcgtgttcaacttc
gaaggcggctgctacgcgaagaccatccgtttgtcagaagaagcggaaccggacatctat
cacgccatccgccgcgatgcgctgctggaaaacgtcaccgtgctggccgacggcaccatc
gatttcgacgatgcgtcgaaaacggaaaacacccgcgtctcttacccgatttaccacatc
gacaacatcgtgaagccggtgtcgaaagccgggcacgccaccaaggtgattttcctgacc
gcggacgccttcggcgtactgccgccggtttcccgcctgacggcgaaccagacgcagtac
cacttcctttctggctttaccgcgaagctcgccggtaccgagcgcggcgtcaccgagccg
acgccaaccttctccgcctgctttggcgcagcgttcctctccctgcacccgacccagtat
gcagaagtgctggtgaagcgtatgcaggcgtccggcgcgcaggcctatctggtgaacacc
ggctggaacggcaccggcaaacgtatctccattaaggatacccgcgccattatcgatgcc
attctggacggctctctggataacgctgaaacctttactctgccgatgttcgatctggcg
atcccaacggcgctgccaggcgtggatacgcatatcctcgacccgcgcaacacctacggt
tcaccggagcagtggcgtgagaaagcggagacgctggcgaagctgtttattgagaacttt
gagaagtataccgataccccggcgggcgaagcgctggtgagtgcgggtccgaaactgtaa

DBGET integrated database retrieval system