KEGG   Klebsiella sp. LTGPAF-6F: BJF97_00610Help
Entry
BJF97_00610       CDS       T05751                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00561  Glycerolipid metabolism
kll00640  Propanoate metabolism
kll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJF97_00610 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BJF97_00610 (gldA)
Enzymes [BR:kll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BJF97_00610 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AOV09631
UniProt: A0A1D8JLP7
Position
complement(131372..132475)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVITRLGGYLKPLAERWLIVGDKFVLGFAEEKLRKSLADAGLAGE
IAPFGGECSHNEINRLRDIAGSARCTAVLGIGGGKTLDTAKALAHFMNLPVVIAPTIAST
DAPCSALSVIYTDDGEFDSYLMLPRNPNMVIVDTQIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLVEEGEKAMLATEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAIHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLDIKVDIPGKMRTVAEAACAEGETIHNMPGGATPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcaatcacccggtaagtacattcagggcgcggacgtcattacccgc
cttggtggatacctaaagccgctggcagaacgctggctcatcgtgggcgataaattcgta
ctcggttttgccgaagaaaaactgcgtaaaagcctggcggatgcggggctggctggcgaa
atcgcaccgtttggcggcgaatgctcacataacgaaatcaaccgcttgcgtgatattgcc
ggttccgcccgctgcaccgccgtgctgggtatcggcggcggcaagacgctggataccgca
aaagcattagcacactttatgaatctgccggtggttattgccccgacgattgcctccacc
gacgcgccgtgcagcgcgctctcggtcatctataccgatgacggcgagtttgatagctac
ctgatgctgccgcgcaacccgaacatggtcattgtcgatacgcaaatcgttgctggcgcc
ccggcgcgcctgctggcagccggtatcggtgatgcgctggcgacctggtttgaagcgcgt
gcctgctcccgcagcggcgcgaccaccatggcgggcggaaaatgcacccaggcggcgctg
gcgctggctgaactgtgctacaacacgctggttgaagagggcgaaaaagcgatgctggcg
acggagcagcacgtggtgacgccggcgctggaacgggtgattgaagccaacacctatctg
agcggcgtcggctttgaaagcggcggcctggcggctgcgcacgctatccataacggtcta
accgctattccggacgctcaccactactatcatggtgaaaaagtggctttcggtacgctt
acgcagctggtactggaaaacgcgccggtggaagagatcgaaaccgtagcggcgctgtgc
catagcgtcgggctgcctatcaccctggcgcagctggatattaaagtcgatatcccgggc
aaaatgcgtaccgtggcggaagccgcctgcgcggaaggtgaaaccatccacaatatgccc
ggcggcgcgacgccggatcaggtctatgccgcgcttctggtggccgaccagtacggtcaa
cgcttcctgcaagagtgggaataa

DBGET integrated database retrieval system