KEGG   Klebsiella sp. LTGPAF-6F: BJF97_01430Help
Entry
BJF97_01430       CDS       T05751                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00620  Pyruvate metabolism
kll00630  Glyoxylate and dicarboxylate metabolism
kll01100  Metabolic pathways
kll01110  Biosynthesis of secondary metabolites
kll01120  Microbial metabolism in diverse environments
kll01200  Carbon metabolism
Module
kll_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJF97_01430
   00630 Glyoxylate and dicarboxylate metabolism
    BJF97_01430
Enzymes [BR:kll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BJF97_01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AOV09764
UniProt: A0A1D8JM38
Position
304702..306303
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGDQEKQILTPEAVEFLTELVRRFTPERNKLLAARIQQQQAIDN
GKLPDFISETASIRNGDWTIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPALLICRVRGLHLPEKHVTWR
REAIPGSLFDFALYFFHNYKALLEKGSGPYFYLPKTQAWQEAAWWSEVFSFTEDRFELPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAELNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNGELGENKNQLSVTREDDAPITAEQLLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGTPVTKALFR
QWLAEEMRVIQDELGEHRYSSGRFDEAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcactgacgaactggcttttagccagccatatggcgaccag
gagaagcaaatcttaacgcctgaggccgtagaatttctgaccgagctggtgcgccgcttt
acgcctgagcgcaataaactcctggccgcgcgtatccagcagcagcaggcaattgataac
ggtaagcttccagattttatttcggaaacagcttccattcgcaacggtgattggacgatc
cgcggtatcccggacgatttgcaggatcggcgggtagaaattaccggtccggtagagcgc
aagatggtcatcaatgcgctcaatgcgaatgtaaaagtctttatggcggatttcgaagac
tcactggcgcccgaatggagcaaagtcattgatgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctacaccaatgaagccggcaagatttatcagctgaagccgaacccg
gcgctgctgatctgccgcgtgcgcggtctgcatctgccggaaaaacacgtgacgtggcgc
agggaagcgattcccggcagtctgttcgacttcgccctctatttcttccacaactacaaa
gcgttactggaaaaaggcagcggcccctatttctatctgccgaagactcaggcctggcag
gaagccgcgtggtggagtgaagtatttagctttacggaagaccgttttgagctgccgcgc
ggcaccatcaaagccacgctgctgatcgaaacgctgcccgccgtattccagatggacgaa
attctgcacgccctgcgcgaccatattgtgggtctgaactgcgggcgctgggactacatc
ttcagctatatcaaaacgctgaagaatcatccggatcgcgttctgccggaccgtcaggtg
gtgacgatggacaagcctttcctcagcgcctactcgcgattgttgattaagacctgccac
aggcgcggcgcgtttgcgatgggcggcatggcggcctttattccgagcaaagatgccgag
ctaaacaaccaggtgctgaacaaggtaaaagcggacaaatcgctggaggcgaataacggt
catgacggtacctggatcgcgcatcccgggctggctgacaccgcgatggccgtctttaac
ggcgaactgggcgagaacaaaaatcagctgtccgttacccgcgaagacgatgcgccgatt
accgctgaacagctgctggccccctgcgagggcgaacgaaccgaagagggcatgcgcgcc
aacattcgcgtggcggtgcagtatatcgaggcgtggatttccggcaacggctgcgtaccg
atttatggcctgatggaagatgcggcgacggcggaaatctcccgtacctctatctggcaa
tggatccaccatgagaaaaccctcagtaacggcacaccggttaccaaagcgctgttccgc
cagtggctggctgaagagatgcgggtgattcaggacgaactgggcgaacaccgctacagc
agcggacgttttgacgaggccgcgcgcctgatggaacagatcaccacctccgacgagctg
atcgatttcttaaccctgccgggctaccgccttctggcctaa

DBGET integrated database retrieval system