KEGG   Klebsiella sp. LTGPAF-6F: BJF97_11735Help
Entry
BJF97_11735       CDS       T05751                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
kll  Klebsiella sp. LTGPAF-6F
Brite
KEGG Orthology (KO) [BR:kll00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJF97_11735
Enzymes [BR:kll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     BJF97_11735
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     BJF97_11735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Rapsyn_N
Motif
Other DBs
NCBI-ProteinID: AOV11668
UniProt: A0A1D8JSI7
Position
2518170..2519177
Genome map
AA seq 335 aa AA seqDB search
MSQEKKPVVALTIGDPAGIGPEISVATMMEKSVYDECKPFLIGSAPIIARAMKIMGCDFP
INKISHPQEARFSWGTLDVLETDDYDCESIEWGKVQKLAGQMSLDYVLKSIELGKAGLID
VVSTAPIHKEAIKLAGCKLPGHTEIYQVETQSDYGLTMFHVHNLRVFFVSRHMALKDACD
YANKERVLACVQQIHHEFTALNIKNPRIAVAALNPHGSDNGLFGHEEADNLIPAVKAAQE
MGINAIGPVPADSVFHLGKQGRYDAILSLYHDQGHIACKTLDFERSVTITFGLPFMRSSV
DHGTAFDIAGTGKAGTVSMLEPTMAAVSYWKMKNH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagagaaaaagcccgttgtcgcacttaccattggcgatcctgccgggattggt
ccggagatttcagtcgcgacgatgatggagaaaagcgtctacgacgagtgcaaacctttt
ttgattggctcagcgccgattatcgccagagcaatgaaaatcatgggctgtgattttccg
attaacaaaattagccatccgcaggaagctcgcttcagctggggtacgctggacgtgctg
gaaaccgatgattatgactgcgagagcattgaatggggcaaagtgcagaagctggcgggg
cagatgtcgctggactatgtgctgaaatctatcgaactggggaaagccggcctgatcgat
gtggtctctaccgcgccgattcataaagaagcaatcaagctggcggggtgtaaacttccg
ggtcataccgagatctatcaggttgaaacgcaatccgattatggcctgaccatgttccac
gttcataacctgcgggtcttcttcgtgagccgtcatatggcgcttaaagacgcctgcgat
tacgccaataaagagcgcgttctggcctgcgtgcagcagatccaccatgagttcaccgcg
ctaaatatcaaaaatccgcgcattgcggtagctgcgctgaatccgcatggttcagacaac
ggcctgtttggccacgaagaagccgataacctcatcccggcagtcaaagcggcgcaggaa
atggggattaacgccatcggcccggtgccggcagattccgtcttccatctgggtaaacag
gggcgctatgacgccatcctctcgctttaccacgatcaggggcatatcgcctgtaaaacc
ctcgattttgagcgttccgtgaccattacctttggcctgccgtttatgcgtagctcggta
gaccacggcacggcgtttgatattgccggcaccggtaaagcgggcaccgtcagtatgctg
gagcccacgatggccgcggtgagctactggaaaatgaaaaaccactaa

DBGET integrated database retrieval system