KEGG   Klebsiella sp. LTGPAF-6F: BJF97_26540Help
Entry
BJF97_26540       CDS       T05751                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kll00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BJF97_26540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kll03011]
    BJF97_26540
Ribosome [BR:kll03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BJF97_26540
  Bacteria
    BJF97_26540
  Archaea
    BJF97_26540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOV14396
UniProt: A0A1D8K0C6
Position
complement(5651664..5651996)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaat
aagaaagctgctgtactggtcaagaaggtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system