KEGG   Klebsiella sp. LTGPAF-6F: BJF97_27440Help
Entry
BJF97_27440       CDS       T05751                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kll00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJF97_27440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kll02022]
    BJF97_27440
Two-component system [BR:kll02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BJF97_27440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AOV14566
UniProt: A0A1D8K0U3
Position
5840309..5841028
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaattataagattctggttgtcgatgacgacatgcgcctgcgtgcgctactc
gaacgttatctgaccgagcagggcttccaggttcgtagcgtggcgaacgctgaacagatg
gatcgcctgctgacccgtgaatccttccacctgatggtgctggatctgatgctgccgggc
gaagatggcctgtccatttgccgccgcctgcgcagccagagcaacccgatgccgatcatt
atggtcacggcgaaaggggaagaagttgaccgtatcgtgggcctggaaatcggcgccgac
gactacatcccaaaaccgttcaacccgcgcgagctgctggcccgtatccgcgccgtactg
cgccgtcaggctaacgaactgccgggcgcgccttcgcaggaagaagcggttatcgccttt
ggtaagttcaagctgaacctcggcacccgcgagatgttccgcgaagatgagcctatgccg
ctgaccagcggtgaattcgcggtactgaaagcgctggtgagccatccgcgcgaaccatta
tcccgcgataagctgatgaacctcgctcgcggccgtgaatattcggccatggagcgctcc
atcgacgtacaaatctcccgcctgcgccgcatggtggaagaagatccggcgcatccgcgc
tatatccagaccgtttggggcctgggctacgttttcgtcccggacggctctaaggcatga

DBGET integrated database retrieval system